SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018287 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018287
Domain Number 1 Region: 22-165
Classification Level Classification E-value
Superfamily C-type lectin-like 1.5e-32
Family C-type lectin domain 0.000000675
Further Details:      
 
Domain Number 2 Region: 242-307
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000132
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 3 Region: 180-245
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000005
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 4 Region: 296-364
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000104
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 5 Region: 423-490
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000556
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 6 Region: 366-439
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000082
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 7 Region: 488-549
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000375
Family Complement control module/SCR domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018287   Gene: ENSNLEG00000015020   Transcript: ENSNLET00000019196
Sequence length 610
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:20053368:20065164:-1 gene:ENSNLEG00000015020 transcript:ENSNLET00000019196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIASQFLSALTLVLLIKEGRAWSYNTSREAMTYDEASAYCQQRYTHLVAIQNKEEIEYLN
SILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREK
DVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLECEQIVNC
TAPESPEHGSLVCSHPLGNFSYNSSCSVSCDRGYLPSSMETTQCMSSGEWSAPIPACNVV
ECDAVTNPANGFVECFPNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEMPMCK
AVTCKAIRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIP
VCEAFQCMALSNPERGYMNCLPSASGSFHNGSSCEFSCEQGFVLKGSERLQCGPTGEWDN
EKPTCEAVRCNAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQ
WTEEIPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCEFTCPEGWTLNGSAALTCSATGHW
SGMLPTCEAPTESNIPLVAGLSAAGLSLLTLAPFLLWLRKCFRKAKKFVPASSCQSLESD
GSYQKPSYIL
Download sequence
Identical sequences G1RYG0
XP_003258895.1.23891 ENSNLEP00000018287 ENSNLEP00000018287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]