SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000018451 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000018451
Domain Number 1 Region: 149-305
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.77e-26
Family Dual specificity phosphatase-like 0.026
Further Details:      
 
Domain Number 2 Region: 16-122
Classification Level Classification E-value
Superfamily Starch-binding domain-like 9.57e-16
Family Starch-binding domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000018451   Gene: ENSNLEG00000015203   Transcript: ENSNLET00000019376
Sequence length 331
Comment pep:known_by_projection supercontig:Nleu1.0:GL397266.1:37508599:37621955:-1 gene:ENSNLEG00000015203 transcript:ENSNLET00000019376 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFRFGVVVPPAVAGARPELLVVGSRPELGCWEPRGAVRLRPAGTAAGAGALALQEPGLW
LGEVELAAEEAAQDGAEPGRVDTFWYKFLKREPGGELSWEGNGPHHDRCCTYNENNLVDG
VYCLPVGHWIEATGHTNEMKHTTDFYFNIAGHQAMHYSRILPNIWLGSCPRQVEHVTIKL
KHELGITAVMNFQTEWDIVQNSSGCNRYPEPMTPDTMIKLYREEGLAYIWMPTPDMSTEG
RVQMLPQAVCLLHALLEKGHIVYVHCNAGVGRSTAAVCGWLQYVMGWNLRKVQYFLMAKR
PAVYIDEEALARAQEDFFQKFGKVRSSVCSL
Download sequence
Identical sequences G1RYX4
ENSNLEP00000018451 XP_003255887.1.23891 ENSNLEP00000018451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]