SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019439 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019439
Domain Number 1 Region: 25-195
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 4.17e-58
Family MHC antigen-recognition domain 0.00000497
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019439   Gene: ENSNLEG00000016038   Transcript: ENSNLET00000020424
Sequence length 216
Comment pep:novel supercontig:Nleu1.0:GL397275.1:31833634:31848643:1 gene:ENSNLEG00000016038 transcript:ENSNLET00000020424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGELMAFLLPLIIVLMVKRSDSWTHSLRYFGLGISDPGHGVPEFISVGYVDSHLITTYDS
VTRQKEPRAPWMAENLAPDHWERGTQLLRGLQQTFKVELKRLQRHYNHSGSHTYQGMTGC
ELLEDGSTTGFLQYAYDGQDFLIFSKDTLSWLAVDNVAHTIRAWEANQHELHYQRSLEEE
CMAWLRRFEYGKDTLREQVKRKRSLIRTCLNNCFYT
Download sequence
Identical sequences ENSNLEP00000019439 ENSNLEP00000019439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]