SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019565 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019565
Domain Number 1 Region: 786-894
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-23
Family Spermadhesin, CUB domain 0.0027
Further Details:      
 
Domain Number 2 Region: 266-391
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.08e-19
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 3 Region: 11-150
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.77e-17
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 4 Region: 173-306
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000282
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 5 Region: 628-783
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000848
Family Growth factor receptor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019565   Gene: ENSNLEG00000016115   Transcript: ENSNLET00000020555
Sequence length 972
Comment pep:known_by_projection supercontig:Nleu1.0:GL397297.1:23114978:23273033:-1 gene:ENSNLEG00000016115 transcript:ENSNLET00000020555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGTRGRKGGRGLTGSVDVDECSEGTDDCHIDAICQNTPKSYKCLCKPGYKGEGKQCEDID
ECENDYYNGGCVHECINIPGNYRCTCFDGFMLAHDGHNCLDVDECQDNNGGCQQICINAM
GSYECQCHSGFFLSDNQHTCIHRSNEGMNCMNKDHGCAHICRETPKGGVACDCRPGFDLA
QNQKDCTLTCNYGNGGCQHSCEDTDTGPMCGCHQKYALHSDGRTCIETCAVNKRGCNWMC
KDTATGVRCSCPIGFTLQPDRKTGKDINECLVNNGGCDHFCRNTVGSFECGCRKGYKLLT
DERTCQDIDECSFERTCDHICINSPGSFQCLCHRGYILYGTTHCGDVDECSISNGSCDQG
CINTKGSYECVCPPGRRLHWNRKDCVETGKCLSRAKTSPRAQLSCSKVGGVESCFLSCPA
HTLFVPDSENSYVLSCGVPGPQGKALQKRNGTSSGLGPSCSDAPTTPIKQKARFKIQDAK
CHLQPHSQAGAKETTRQPLLDHCHVTFVTLKCDSSKKRCRGRKSPSKEVSHITAEFEIET
KMEEASDTCEADCLRKRAEQSLQAAIKTLRKSIGRQQFYVQVSGTEYEVAQRPAKALEGQ
GACGAGQVLQDSKCIACGPGTHFSGELGQCVPCMPGTYQDTEGQLSCTPYPSSDGLGLAG
ARNVSECGGQCSPGFFSADGFKPCQACPVGTYQPEPGRTGCFPCGGGLLTKHEGTTSFQD
CEAKVHCSPGHHYNTTTHHCIRCPIGTYQPEFGQNHCITCPGNTSTDFDGSTNVTHCKNQ
HCGGELGDYTGYIESPNYPGDYPANAECVWHIVPPPKRRILIVVPEIFLPVEDECGDVLV
TRKSASPTSITTYETCQTYERPIAFTSRSRKLWIQFKSNEGNSGKGFQVPYVTYDEDYQQ
LIEDIVRDGRLYASENHQEILKDKKLIKALFDVLAHPQNYFKYTAQESKEMFPRSFIKLL
RSKVSRFLRPYK
Download sequence
Identical sequences ENSNLEP00000019565 ENSNLEP00000019565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]