SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019849 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019849
Domain Number 1 Region: 316-615
Classification Level Classification E-value
Superfamily Kelch motif 3.66e-44
Family Kelch motif 0.0071
Further Details:      
 
Domain Number 2 Region: 707-876
Classification Level Classification E-value
Superfamily C-type lectin-like 2.75e-26
Family C-type lectin domain 0.0012
Further Details:      
 
Domain Number 3 Region: 90-212
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.8e-21
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 4 Region: 1013-1059
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000318
Family Laminin-type module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000019849
Domain Number - Region: 60-93
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0265
Family EGF-type module 0.046
Further Details:      
 
Domain Number - Region: 249-331
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.0353
Family Galactose oxidase, central domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019849   Gene: ENSNLEG00000016356   Transcript: ENSNLET00000020847
Sequence length 1378
Comment pep:known_by_projection supercontig:Nleu1.0:GL397265.1:49091126:49960305:1 gene:ENSNLEG00000016356 transcript:ENSNLET00000020847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METGGRARTGPPQPAAPGLWRARPAGGGGGGASSWLLDGNSWLLCYGFLYLALYAQVSQS
KPCERTGSCFSGRCVNSTCLCDPGWVGDQCQHCQGRFKLTEPSGYLTDGPINYKYKTKCT
WLIEGYPNAVLRLRFNHFATECSWDHMYVYDGDSIYAPLIAVLSGLIVPEIRGNETVPEV
VTTSGYALLHFFSDAAYNLTGFNIFYSINSCPNNCSGHGRCTTSVSVPSQVYCECDKYWK
GEACDIPYCKANCGSPDHGYCDLTGEKLCVCNDSWQGPDCSLNVPSTESYWILPNVKPFS
PSVGRASHKAVLHGKFMWVIGGYTFNYSSFQMVLKVFXXXXXXXXXLSRGPLQRYGHSLA
LYQENIFMYGGRIETNDGNVTDELWVFNIHSQSWSTKTPTVLGHGQQYAVEGHSAHIMEL
DSRDVVMIIIFGYSAIYGYTSSIQEYHISSNTWLVPETKGAIVQGGYGHTSVYDEITKSI
YVHGGYKALPGNKYGLVDDLYKYEVNTKTWTILKESGFARYLHSAVLINGAMLIFGGNTH
NDTSLSNGAKCFSADFLAYDIACDEWKILPKPNLHRDVNRFGHSAVVINGSMYIFGGFSS
VLLNDILVYKPPNCKAFRDEELCKNAGPGIKCVWNKNHCESWESGNTNNILRAKCPPKTA
ASDDRCYRYADCASCTANTNGCQWCDDKKCISANSNCSMSVKNYTKCHVRNEQICNKLTS
CKSCSLNLNCQWDQRQQECQALPAHLCGEGWSHVGDACLRVNSSRENYDNAKLYCYNLSG
NLASLTTSKEVEFVLDEIQKYTQQKVSPWVGLRKINISYWGWEDMSPFTNTTLQWLPGEP
NDSGFCAYLERAAVAGLKANPCTSMANGLVCEKPVVSPNQNARPCKKPCSLRTSCSNCTS
NGMECMWCSSTKRCVDSNAYIISFPYGQCLEWQTATCSPQNCSGLRTCGQCLEQPGCGWC
NDPSNTGRGHCIEGSSRGPMKLIGMHHNEMVLDTNLCPKEKNYEWSFIQCPACQCNGHST
CINNNVCEQCKNLTTGKQCQDCMPGYYGDPTNGGQCTVCTCSGHANICHLHTGKCFCTTK
GIKGDQCQLCDSENRYVGNPLRGTCYYSLLIDYQFTFSLLQEDDRHHTAINFIANPEQSN
KNLDISINASNNFNLNITWSVGSTAGTISGEETPIVSKNNIKEYRDSFSYEKFNFRSNPN
ITFYVYVSNFSWPIKIQIAFSQHNTIMDLVQFFVTFFSCFLSLLLVAAVVWKIKQTCWAS
RRREQLLRERQQMASRPFASVDVALEVGAEQTEFLRGPLEGAPKPIAIEPCAGNRAAVLT
VFLCLPRGSSGAPPPGQSGLAIASALIDISQQKASDSKDKTSGVRNRKHLSTRQGTCV
Download sequence
Identical sequences ENSNLEP00000019849 ENSNLEP00000019849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]