SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000019939 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000019939
Domain Number 1 Region: 103-134
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000668
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 2 Region: 69-113,507-542
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000785
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000019939   Gene: ENSNLEG00000016425   Transcript: ENSNLET00000020938
Sequence length 561
Comment pep:known_by_projection supercontig:Nleu1.0:GL397362.1:3473097:3551701:-1 gene:ENSNLEG00000016425 transcript:ENSNLET00000020938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSACRSFAVAICILEISVLTAQYTTSYDPELTERSGSTSHIDCRMSPWSEWSQCDPCLRQ
MFRSRSIEVFGQFNGKSCTDAVGDRRQCVPTEPCEDAEDDCGNDFQCSTGRCIKRRLQCN
GDNDCGDFSDEDDCESDPRPPCRDRVVEESELARTAGFGINILGMDPLSTPFDNEFYNGL
CNRDRDGNTLTYYRRPWNVASLVYETKGEKNFRTEHYEEQIQAFKSIVQEKTSNFNADIS
LKFTPTEANKVETENPSEETASSNSLHGKGSFRFSYSKNETYQLFLSYSSKKEKMFLHVK
GEIHLGRFVMRNRDVVLTATFVDDIKALPTTYEKGEYFAFLETYGTHYSSSGSLGGLYEL
IYVLDKASMNRKGVEIKDIKRCLGYHLDVSLDFSSISAGAKVNKDDCVKRGEGRAVNITS
DNLIDDVISLIRGGTRKYAFELKEKLLRGTMIDVTDFVNWASSINDAPVLISQKLSPIYN
LVPVKMKNAHLKKQNLERAIEDYINEFSVRKCHTCQNGGTVILMDGKCLCACPFKFEGIA
CEISKQKISEGLPALDFPSEK
Download sequence
Identical sequences G1S351
ENSNLEP00000019939 XP_003274417.1.23891 ENSNLEP00000019939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]