SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020085 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020085
Domain Number 1 Region: 483-737
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-49
Family YWTD domain 0.00000409
Further Details:      
 
Domain Number 2 Region: 46-300
Classification Level Classification E-value
Superfamily YWTD domain 1.28e-36
Family YWTD domain 0.0000677
Further Details:      
 
Domain Number 3 Region: 400-476,733-784
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000314
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 4 Region: 974-1018
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000344
Family EGF-type module 0.00024
Further Details:      
 
Domain Number 5 Region: 349-397
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000259
Family EGF-type module 0.015
Further Details:      
 
Domain Number 6 Region: 870-923
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000363
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 7 Region: 831-881
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000965
Family EGF-type module 0.039
Further Details:      
 
Domain Number 8 Region: 915-953
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000232
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000020085
Domain Number - Region: 324-357
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00125
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020085   Gene: ENSNLEG00000016536   Transcript: ENSNLET00000021091
Sequence length 1207
Comment pep:known_by_projection supercontig:Nleu1.0:GL397323.1:6165232:6266381:-1 gene:ENSNLEG00000016536 transcript:ENSNLET00000021091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLILFILLPVVLKFSFVSLSAPQHWRCPEGTLAGNGNSTCVGPAPFLIFSHGNSIFRID
TEGTNYEQLVVDAGVSVIMDFHYNEKIIYWVDLERQLLQRVFLNGSRQERVCNIEKNVSG
MAINWINEEVIWSNQQEGIITVTDMKGNNSHVLLRALKYPANIAVDPVERFIFWSSEVAG
SLYRADLDGVEVKALLETSEKITAVSLDVLDKRLFWIQYNREGSNSLICSCDYDGGSVHI
SKHPTQHNVFAMSVFGDRIFYLTWKTKTIWIANKHTGKDMVRINLHSSFVPPGELKVVHP
LAQPKAEDDAREPEQKLRKLRKGNCSSTVCGQDPQSHLCTCAEGYALSRDRKYCEDVNEC
AFWNHGCTLGCKNTPGSYYCTCPVGFVLLPDGKRCHQLVSCPSNVSECSHDCVLTSEGPL
CFCPEGSVLERDGKTCSGCSSPDNGGCSQLCIPLSPVSWECDCFPGYDLQLDKKSCAASG
PQPFLLFANSQDIRHMHFDGTDYGTLLSQQMGMVYALDHDPVENKIYFAHTALKWIERAN
MDGSQRERLIEEGVDVPEGLAVDWIGRRVYWTDRGKSLIGRSDLNGKRSKIITKENISQP
RGIAVHPMAKRLFWTDTGINPRIESSSLQGLGRLVIASSDLIWPSGITIDFLTDKLYWCD
AKQSVIEMANLDGSKRQRLTQNDVGHPFAVAVFEDYVWFSDWAMPSVMRVNKRTGKDRVR
LQGSMLKPSSLVVVHPLAKPGADPCLYQNGGCEHICKERLGTAWCSCREGFMKASDGKTC
LALDGHQLLAGGEVDLKNQVTPLDILSETRVSEDNITESQQMLVAEIMVSDQDDCAPVGC
STYARCISEGEDATCQCLKGFAGDGKLCSDIDECEMGVPVCPPASSKCINTEGGYVCQCS
EGYQGDGIHCFDIDECQLGVHSCRENANCTNTEGGYTCMCAGRLSEPGLICPDSTPPPHL
REDDHHYSIRNSDSGCPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYQDLKWW
ELRHAGHGQQRKVTVVAVCVVVLVVLLLLSLWGAHYYRTQKLLSKNPKNPYEESSRDVRS
RRPADTEDGMSSCPQPWFVVVKEHQDLRNGSQPVAGEDGQAADGSVQPTSWRQEPQLCGM
GTGQGFWIPVSSDKGSCPQVMEQSFHMPSYGTQPLEGGVEKPHSLLSANPLWQQRALDPP
HQMELTQ
Download sequence
Identical sequences ENSNLEP00000020085 ENSNLEP00000020085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]