SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020453 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020453
Domain Number 1 Region: 37-204
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.58e-43
Family Dual specificity phosphatase-like 0.0000411
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020453   Gene: ENSNLEG00000016840   Transcript: ENSNLET00000021469
Sequence length 221
Comment pep:known_by_projection supercontig:Nleu1.0:GL397335.1:9335889:9357687:-1 gene:ENSNLEG00000016840 transcript:ENSNLET00000021469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSGEVKTSLKNAYSSAKRLSPKMEEEGEEEDYCTPGAFELERLFWKGSPQYTHVNEVWP
KLYIGDEATALDRYRLQKAGFTHVLNAAHGRWNVDTGPNYYRDMDIQYHGVEADDLPTFD
LSVFFYPAAAFIDRALRDDHSKILVHCVMGRSRSATLVLAYLMIHKDMTLVDAIQQVAKN
RCVLPNRGFLKQLRELDKQLVQQRRQAQCQDGEEEEDSREL
Download sequence
Identical sequences G1S4L5
ENSNLEP00000020453 XP_003271324.1.23891 ENSNLEP00000020453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]