SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020652 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020652
Domain Number 1 Region: 355-412
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.65e-25
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 2 Region: 299-356
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 411-468
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.82e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 109-169
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.07e-22
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 5 Region: 453-505
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.48e-21
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 6 Region: 246-300
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.2e-20
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000020652
Domain Number - Region: 229-254
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0289
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020652   Gene: ENSNLEG00000026641   Transcript: ENSNLET00000021685
Sequence length 511
Comment pep:known_by_projection supercontig:Nleu1.0:GL397261.1:47743806:47765108:1 gene:ENSNLEG00000026641 transcript:ENSNLET00000021685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRRGLGKDIEGRWGAGALGPGRSGLKGGRVWEAEAGGSRGQEIETILANIETSLRSGQI
PTLDSSEHNLSSEPLELDRMPHSPLISIPRVWCHPEEEERMHDELLQAVSKGPVMFRDVS
IDFSQEEWECLDAGQMNLYKEVMLENFSNLVSVGLSNSKPAVISLLEQGKEPWMVDRELT
RGLCSDLESMCETKILSLKKRHFSQVILNHEDMSTFIQPTFLIPPQKTMSEKKPWECKIC
GKTFSQNSQFIQHQRIHFGEKPYESKEYGKSFSRGSLVTRHQRIHTGKKPYECKECGKAF
SCSSYFSQHQRIHTGEKPYECKECGKAFKYCSNLNDHQRIHTGEKPYECKVCGKAFTKSS
QLFLHLRIHTGEKPYECKECGKAFTQHSRLIQHQRMHTGEKPYECKQCGKAFNSASTLTN
HRRIHAGEKLYECEECRKAFIQSSELIQHQRIHTDEKPYECNECGKAFNKGSNLTRHQRI
HTGEKPYDCKECGKAFGSRSDLIRHEGIHTG
Download sequence
Identical sequences ENSNLEP00000020652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]