SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020698 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020698
Domain Number 1 Region: 773-954
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 6.8e-44
Family Ypt/Rab-GAP domain of gyp1p 0.0038
Further Details:      
 
Domain Number 2 Region: 158-192,231-377
Classification Level Classification E-value
Superfamily PH domain-like 7.26e-32
Family Phosphotyrosine-binding domain (PTB) 0.006
Further Details:      
 
Domain Number 3 Region: 929-1048
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.05e-31
Family Ypt/Rab-GAP domain of gyp1p 0.0044
Further Details:      
 
Domain Number 4 Region: 3-163
Classification Level Classification E-value
Superfamily PH domain-like 1.64e-20
Family Phosphotyrosine-binding domain (PTB) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020698   Gene: ENSNLEG00000017022   Transcript: ENSNLET00000021732
Sequence length 1168
Comment pep:known_by_projection supercontig:Nleu1.0:GL397274.1:29160363:29393781:1 gene:ENSNLEG00000017022 transcript:ENSNLET00000021732 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPITFTARKHPLPNEVSVDFGLQLVGSLPVHSLTTMPMLPWVVAEVRRLSRQSSRKKPV
TKQVRLCVSPSGLRCEPEPGRSQQWDPLIYSSIFECKPQHVHKLIHNSHDPSYFACLIKE
DAVHRQSICYVFKADDQTKVPEIISSIRQAGKIARQEELHCPSEFDDTFSKKFEVLFCGR
VTVAHKKAPPALIDECIQKFNHVSGSRGSERPRPAPPPAAPTGSQEPGRRPMRKSFSQPG
LRSLAFRKELQDGGLRSSGFFSSFEESDIENHLISGHNIVQPTDIEENRTMLFTIGQSEV
YLISPDTKKIALEKNFKEISFCSQGIRHVDHFGFICRESSGGGGFHFVCYVFQCTNEALV
DEIMMTLKQAFTVAAVQQTAKAPAQLCEGCPLQGLHKLCERIEGMNSSKTKLELQKHLTT
LTNQEQATIFEEVQKLRPRNEQRENELIISFLRCLYEEKQKEHIHIGEMKQTSQMAAENI
GSELPPSATRFRLDMLKNKAKRSLTESLESILSRGIKARSLQEHSTSVDLDSSVSSTLSN
TSKEPSVCEKEALPISESSFKLLGSSEDLSSDSESHLPEEPAPLSPQQAFRRRANTLSHF
PMECQEPPQPARGSPGVSQRKLMRYHSVSTETPHERKDFESKANHLGDSGGTPVKTRRHS
WRQQIFLRVATPQKACDSSSRYEDYSELGELPPRSPLEPVCEDGPFGPPPEEKKRTSREL
RELWQKAILQQILLLRMEKENQKLQASENDLLNKRLKLDYEEITPCLKEVTTVWEKMLST
PGRSKIKFDMEKIHSAVGQGVPRHHRGEIWKFLAEQFHLKHQFPSKQQPKDVPYKELLKQ
LTSQQHAILIDLGRTFPTHPYFSAQLGAGQLSLYNILKAYSLLDQEVGYCQGLSFVAGIL
LLHMSEEEAFKMLKFLMFDMGLRKQYRPDMIILQIQMYQLSRLLHDYHRDLYNHLEEHEI
GPSLYAAPWFLTMFASQFPLGFVARVFDMIFLQGTEVIFKVALSLLGSHKPLILQHENLE
TIVDFIKSTLPNLGLVQMEKTINQVFEMDIAKQLQAYEVEYHVLQEELIDSSPLSDNQRM
DKLEKTNSSLRKQNLDLLEQLQVANGRIQSLEATIEKLLSSESKLKQAMLTLELERSALL
QTVEELRRRSAEPSDREPECTQSEPTGD
Download sequence
Identical sequences G1S5B0
ENSNLEP00000020698 XP_003258615.1.23891 ENSNLEP00000020698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]