SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000020909 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000020909
Domain Number 1 Region: 386-710
Classification Level Classification E-value
Superfamily DNase I-like 2.36e-58
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.0001
Further Details:      
 
Domain Number 2 Region: 1174-1236
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000359
Family SAM (sterile alpha motif) domain 0.0099
Further Details:      
 
Domain Number 3 Region: 40-97
Classification Level Classification E-value
Superfamily SH2 domain 0.00000187
Family SH2 domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000020909   Gene: ENSNLEG00000017207   Transcript: ENSNLET00000021959
Sequence length 1238
Comment pep:known_by_projection supercontig:Nleu1.0:GL397264.1:18228804:18242654:-1 gene:ENSNLEG00000017207 transcript:ENSNLET00000021959 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEKFGHSPADPFRHPPGRREQGRGCAFHVVCSPVWIGTEWYQKHVHTYRILPDGEDFLA
VQTSQGVPVRRFQTLGELIGLYAQPNQGLVCALLLPVEGEREPDPPDDRDASDGEDEKPP
LPPRSGSTSISAPTGPSSPLPAPETPTTPAAESAPNGLSTVSHEYLKGSYGLDLEAVRSG
ASHLPHLTRTLATSCRRLHSEVDKVLSGLEILSKVFDQQSSPMVTRLLQQQNLPQTGEQE
LESLVLKLSVLKDFLSGIQKKALKALQDMSSTAPPAPQPSTRKAKTIPVQAFEVKLDVTL
GDLTKIGKSQKFTLSVDVEGGRLVLLRRQRDSQEDWTTFTHDRIRQLIKSQRVQNKLGVV
FEKEKDRTQRKDFIFVSARKREAFCQLLQLMKNKHSKQDEPDMISVFIGTWNMGSVPPPK
NVTSWFTSKGLGKTLDEVTVTIPHDIYVFGTQENSVGDREWLDLLRGGLKELTDLDYRPI
AMQSLWNIKVAVLVKPEHENRISHVSTSSVKTGIANTLGNKGAVGVSFMFNGTSFGFVNC
HLTSGNEKTARRNQNYLDILRLLSLGDRQLSAFDISLRFTHLFWFGDLNYRLDMDIQEIL
NYISRKEFEPLLRVDQLNLEREKHKVFLRFSEEEISFPPTYRYERGSRDTYAWHKQKPTG
VRTNVPSWCDRILWKSYPETHIICNSYGCTDDIVTSDHSPVFGTFEVGVTSQFISKKGLS
KTSDQAYIEFESIEAIVKTASRTKFFIEFYSTCLEEYKKSFENDAQSSDNINFLKVQWSS
RQLPTLKPILADIEYLQDQHLLLTVKSMDGYESYGECVVALKSMIGSTAQQFLTFLSHRG
EETGNIRGSMKVRVPTERLGTRERLYEWISIDKDEAGAKSKAPSVSRGSQEPRSGSRKPA
FTEASCPLSRLFEEPEKPPPTGRPPAPPRVAPREEPLTPRLKPEGAPEPEGVAAPPPKNS
FNNPAYYVLEGVPHQLLPPEPPSPARAPVPSATKNKVAITVPAPQLGRHRPPRVGEGSSS
DEESGGTLPPPDFPPPPLPDSAIFLPPSLDPLPGPVVRGRGGGEARGPPPPKAHPRPPLP
PGPSPSSTFLGEVASGDDRSCSVLQMAKTLSEVDYAPAGPPRSALLPGPLELQPPPGLPS
DYGRPLSFPPPRIRESIQEDLAEEAPCLQGGRASGLGEAGMSAWLRAIGLERYEEGLVHN
GWDDLEFLSDITEEDLEEAGVQDPAHKRLLLDTLQLSK
Download sequence
Identical sequences ENSNLEP00000020909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]