SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021079 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021079
Domain Number 1 Region: 680-862
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.36e-34
Family SPRY domain 0.00022
Further Details:      
 
Domain Number 2 Region: 38-128
Classification Level Classification E-value
Superfamily RING/U-box 3.95e-29
Family RING finger domain, C3HC4 0.0088
Further Details:      
 
Domain Number 3 Region: 376-459
Classification Level Classification E-value
Superfamily RING/U-box 3.06e-23
Family RING finger domain, C3HC4 0.0046
Further Details:      
 
Domain Number 4 Region: 130-194
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 7.48e-18
Family B-box zinc-binding domain 0.0012
Further Details:      
 
Domain Number 5 Region: 467-527
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000198
Family B-box zinc-binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021079   Gene: ENSNLEG00000017369   Transcript: ENSNLET00000022148
Sequence length 865
Comment pep:known_by_projection supercontig:Nleu1.0:GL397264.1:20132246:20182289:1 gene:ENSNLEG00000017369 transcript:ENSNLET00000022148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLTSGTSWLLIPQMCGSERILQAGNILEIRAEPAGARRVATMTSPVLVDIREEVTCPIC
LELLIEPLSIDCGHSFCQACITPNSGESVIGQEGERSCPVCQTSYQPGNLRPNRHLANIV
RRLREVALGPGKQLKAVLCADHGEKLQLFCQEDGKVICWLCERSQEHRGHHTFLVEEVAQ
EYQEKFQESLKKLKNEEQEAEKLTAFIREKKTSWKARETFSEDNQMEPERRRIQTEFNQL
RNILHRVEQRELKKLEQEEKKGLRIIEEAENDLVYQTQSLRELISDLEHRCQGSTMELLQ
DVSDVTERSEFWTLRKPEALPTKLRSMFRAPDLKRMLRVFRELTDVQSYWGKQGSLTRRE
REPQVRMRRSQGSSAMASKTLLNVQKEVTCPICLELLTEPLSLGCGHSLCRACITVSNKE
VVTSPGGKSSCPVCGISYSFEHLQANQHLANIVEIFKEIKLSPDNGKKGDLCDHHGEKLL
LFCKEDRKVICWLCERSQEHRGHHTFLTEEVFKECQEKLQAVLKRLKKEEEEAEKLEADI
REEKTSWKARGDSEGFMRQESRQDLNPRRPQFDRLRSILNSEEQRELQRLEEEEKKTLDK
FAEAEDELVQQKQLVRELISDVECRSQWSTLELLQDMSGIMKWSEIWRLKKPKTVSKKLK
TVFHAPDLSRMLQMFRELTAVRCYWVDVTLNSVNLNLNLVLSEDQRQVISVPIWPFQCYN
YGVLGSQYFSSGKHYWEVDVSKKTAWILGVYCRTYSRNIKYVVRRCANHQNLYSKYRPLF
GYWVIGLQNKCKYSVFEESLSSDPEVLTLSMAVPPCHYEAGIVSFFNVTSYGSLPRFSKC
CFSQPVYPYFPWNCPAPMTLCPPSS
Download sequence
Identical sequences ENSNLEP00000021079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]