SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021102 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021102
Domain Number 1 Region: 200-469
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-40
Family YWTD domain 0.0000794
Further Details:      
 
Domain Number 2 Region: 24-63
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000236
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 3 Region: 150-192
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000016
Family EGF-type module 0.004
Further Details:      
 
Domain Number 4 Region: 71-106
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 5 Region: 119-160
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000279
Family EGF-type module 0.031
Further Details:      
 
Domain Number 6 Region: 486-523
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000495
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021102   Gene: ENSNLEG00000017387   Transcript: ENSNLET00000022177
Sequence length 540
Comment pep:novel supercontig:Nleu1.0:GL397261.1:55643014:55672992:-1 gene:ENSNLEG00000017387 transcript:ENSNLET00000022177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTPPLLLLLPLLSALVAAAIDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEA
PEICPQSKAQRCQPNEHNCLGTELCVPMSRLCNGVQDCMDGSDEGPHCRELRGNCSRLGC
QHHCVPTLDGPTCYCNSSFQLQADGKTCKDFDECSVYGTCSQLCTNTDGSFICGCVEGYL
LQPDNRSCKAKNEPVDRPPVLLIANSQNILATYLSGAQVSTITPTSTRQTTAMDFSYANE
TVCWVHVGDNAAQTQLKCARMPGLKGFVDEHTINISLSLHHVEQMAIDWLTGNFYFVDDI
DDRIFVCNRNGDTCVTLLDLELYNPKGIALDPAMGKVFFTDYGQIPKVERCDMDGQNRTK
LVDSKIVFPHGITLDLVSRLVYWADAYLDYIEVVDYEGKGRQTIIQGILIEHLYGLTVFE
NYLYATNSDNANAQQKTSVIRVNRFNSTEYQVVTRVDKGGALHIYHQRRQPRVRSHACEN
DQYGKPGGCSDICLLANSHKARTCRCRSGFSLGSDGKSCKKPGARAVPRVWQGPAGIIRG
Download sequence
Identical sequences ENSNLEP00000021102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]