SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021177 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021177
Domain Number 1 Region: 470-551
Classification Level Classification E-value
Superfamily E set domains 3.89e-19
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.000041
Further Details:      
 
Domain Number 2 Region: 643-753
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000415
Family Ankyrin repeat 0.0076
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000021177
Domain Number - Region: 980-1074
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00191
Family Motor proteins 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021177   Gene: ENSNLEG00000017452   Transcript: ENSNLET00000022252
Sequence length 1151
Comment pep:known_by_projection supercontig:Nleu1.0:GL397423.1:3114411:3133886:-1 gene:ENSNLEG00000017452 transcript:ENSNLET00000022252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STDSPSPRPLRPGVTLPPGALTMNTKDTTEVAENSHHLKIFLPKKLLECLPRCPLLPPER
LRWNTNEEIASYLITFEKHDEWLSCAPKTRPQNGSIILYNRKKVKYRKDGYLWKKRKDGK
TTREDHMKLKVQGMECLYGCYVHSSIVPTFHRRCYWLLQNPDIVLVHYNVPALEDCGKGC
SPIFCSISSDRREWLKWSREELLGQLKPMFHGIKWSCGNGTEEFSVEQLVQQILDTHPTK
PAPRTHACLCSGGLGSGSLTHKCSSTKHRIISPKVEPRALTLTSIPHPHPPEPPPLIAPL
PPELPKAHTSPSSSSSSSSSGFAEPLEIRPSPPTSRGGSSRGGTAILLLTGLEQPAGXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRGGRETPIPSPPPSPPPSPAPLEPSSRVGR
GEALFGGPVGASELEPFSLSSFPDLMGELISDEAPSIPAPTPQLSPALSTITDFSPEWSY
PEGGVKVLITGPWTEAAEHYSCVFDHIAVPASLVQPGVLRCYCPAHEVGLVSLQVAGREG
PLSASVLFEYRARRFLSLPSTQLDWLSLDDNQFRMSILERLEQMEKRMAEIAAAGQVPCQ
GPDTPPVQDEGQGPGFEARVVVLISICNSTWKGPERLAHGSPFRGMSLLHLAAAQGYARL
IETLSQWRSVETGSLDLEQEVDPLNVDHFSCTPLMWACALGHLEAAVLLFRWNRQALSIP
DSLGRLPLSVAHSRGHVRLARCLEELQRQEASVEPPLALSPPSSSPDTGLSSVSSPSEMS
DGTFSVTSAYYSAPRWQSPPAPLPTSEMTMDMAPGQLSSGVPEAPLLLMDYEATNSKGPL
SSPPALLPASDDGAAPEDGDSPHAVDVIPVDMISLAKQIIEATPERIKREDFVGLPEAGA
SMRERTGAVGLSETMSWLASYLENVDHFPSSTPPSELPFERGRLAVPSAPSWAEFLSAST
SGKMESDFALLTLSDHEQRELYEAARVIQTAFRKYKGRRLKEQQEVAAAVIQRCYRKYKQ
LTWIALKFALYKKMTQAAILIQSKFRSYYEQKRFQQSRRAAVLIQQHYRSYRRRPGPPHR
PSATLPARNKLLSHQEAGPGSPEDHEIPAALPTQDEGTEAEPGAGRASPARTGHMTWPPP
FSPPWGRLVQS
Download sequence
Identical sequences ENSNLEP00000021177 ENSNLEP00000021177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]