SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021367 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021367
Domain Number 1 Region: 368-396,450-757
Classification Level Classification E-value
Superfamily ARM repeat 3.74e-34
Family Plakophilin 1 helical region 0.014
Further Details:      
 
Domain Number 2 Region: 78-298
Classification Level Classification E-value
Superfamily RNI-like 2.12e-16
Family Cyclin A/CDK2-associated p19, Skp2 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021367   Gene: ENSNLEG00000017607   Transcript: ENSNLET00000022451
Sequence length 767
Comment pep:known_by_projection supercontig:Nleu1.0:GL397294.1:22884917:22927137:-1 gene:ENSNLEG00000017607 transcript:ENSNLET00000022451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASDTPESLMALCTDFCLRNLDGTLGYLLDKETLRLHPDIFLPSEICDRLVNEYVELVNA
ACNFEPHESFFSLFSDPRSTRLTRIHLREDLVQDQDLEAIRKQDLVELYLTNCEKLSAKS
LQTLRSFSHTLVSLSLFGCTNIFYEEENPGGCEDEYLVNPTCQVLVKDFTFEGFSRLRFL
NLGRMLDWVPVESLLRPLNSLAALDLSGIQTSDAAFLTQWKDSLVSLVLYNMDLSDDHIR
VIVQLHKLRHLDISRDRLSSYYKFKLTREVLSLFVQKLGNLMSLDISGHMILENCSISKM
EEEAGQTSIEPSKSSIIPFRALKRPLQFLGLFENSLCRLTHIPAYKVSGDKNEEQVLNAI
EAYTEHRPEITSRAINLLFDIARIERCNQLLRALKPLSFCTLSPGPQDPNPSLGLTALDL
LQHWPCSVPTLVSAPPLLLSLTLNVPHLCPVPAQVQRNCCLTLCNFSIPEELEFQYRRVN
ELLLSILNPTRQDESIQRIAVHLCNALVCQVDNDHKEAVGKMGFVVTMLKLIQKKLLDKI
CDQVMEFSWSALWNITDETPDNCEMFLNFNGMKLFLDCLKEFPEKQELHRNMLGLLGNVA
EVKELRPQLMTSQFISVFSNLLESKADGIEVSYNACGVLSHIMFDGPEAWGVCEPQREEV
EERMWAAIQSWDINSRRNINYRSFEPILRLLPQGISPVSQHWATWALYNLVSVYPDKYCP
LLIKEGGMPLLRDIIKMATARQETKEMARKVIEHCSNFKEENMDTSR
Download sequence
Identical sequences ENSNLEP00000021367 ENSNLEP00000021367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]