SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021413 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021413
Domain Number 1 Region: 42-489
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 6.67e-97
Family Integrin alpha N-terminal domain 0.000000000329
Further Details:      
 
Domain Number 2 Region: 789-1002
Classification Level Classification E-value
Superfamily Integrin domains 9.16e-50
Family Integrin domains 0.0000469
Further Details:      
 
Domain Number 3 Region: 491-647
Classification Level Classification E-value
Superfamily Integrin domains 2.25e-42
Family Integrin domains 0.0000135
Further Details:      
 
Domain Number 4 Region: 648-782
Classification Level Classification E-value
Superfamily Integrin domains 1.49e-31
Family Integrin domains 0.0000298
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021413   Gene: ENSNLEG00000017637   Transcript: ENSNLET00000022500
Sequence length 1049
Comment pep:known_by_projection supercontig:Nleu1.0:GL397261.1:58071385:58095426:1 gene:ENSNLEG00000017637 transcript:ENSNLET00000022500 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSRTPESPLHVVQLRWGPRRRPQLLPLLLLLLPPPPRVGGFNLDAEAPAVLSGPPGSFF
GFSVEFYRPGTDGVSVLVGAPKANTSQPGVLQGGAVYLCPWGASPTQCTPIEFDSKGSRL
LESSLSSSEGEEPVEYKSLQWFGATVRAHGSSILACAPLYSWRTEKEPLSDPVGTCYLST
DNFTRILEYAPCRSDFSWAAGQGYCQGGFSAEFTKTGRVVLGGPGSYFWQGQILSATQEQ
IAESYYPEYLINLVQGQLQTRQASSIYDDSYLGYSVAVGEFSGDDTEDFVAGVPKGNLTY
GYVTILNGSDIRSLYNFSGEQMASYFGYAVAATDVNGDGLDDLLVGAPLLMDRTPDGRPQ
EVGRVYVYLQHPAGIEPTPTLTLTGQDEFGRFGSSLTPLGDLDQDGYNDVAIGAPFGGET
QQGVVFVFPGGPGGLGSKPSQVLQPLWAASHTPDFFGSALRGGRDLDGNGYPDLIVGSFG
VDKAVVYRGRPIVSASASLTIFPAMFNPEERSCSLEGNPVACINLSFCLNASGKHVADSI
GFTVELQLDWQKQKGGVRRALFLASRQATLTQTLLIQNGAREDCREMKIYLRNESEFRDK
LSPIHIALNFSLDPQAPVDSHGLRPALHYQSKSRIEDKAQILLDCGEDNICVPDLQLEVF
GEQNHVYLGDKNALNLTFHAQNVGEGGAYEAELRVTAPPEAEYSGLVRHPGNFSSLSCDY
FAVNQSRLLVCDLGNPMKAGASLWGGLRFTVPHLRDTKKTIQFDFRILNKNLNNSQSDVV
SFRLSVEAQAQVTLNGVSKPEAVLFPVSDWHPRDQPQKEEDLGPAVHHVYELISQGPSSI
SQGVLELSCPQALEGQQLLYVTRVTGLNCTTNHPINPKGLELDPEGSLHHRQKREAPSRS
SASSGPQILKCPEAECFRLRCELGPLHQQESQSLQLHFRVWAKTFLQREHQPFSLQCEAV
YKALKMPYRILPRQLPQKERQVATAVQWTKAEGSYGVPLWIIILAILFGLLLLGLLIYIL
YKLGFFKRSLPYGTAMEKAQLKPPATSDA
Download sequence
Identical sequences ENSNLEP00000021413 ENSNLEP00000021413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]