SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021464 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021464
Domain Number 1 Region: 339-439
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.06e-24
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0018
Further Details:      
 
Domain Number 2 Region: 156-210,238-257
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.68e-16
Family N-terminal PAS domain of Pas kinase 0.054
Further Details:      
 
Domain Number 3 Region: 74-137
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.53e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021464   Gene: ENSNLEG00000017674   Transcript: ENSNLET00000022555
Sequence length 625
Comment pep:known_by_projection supercontig:Nleu1.0:GL397264.1:27853837:28003314:1 gene:ENSNLEG00000017674 transcript:ENSNLET00000022555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGR
LEYTEHQGRIMLFREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQ
HMKTLRGATNPYTEANYKPTFLSDDELKHLILRAADGFLFVVGCDRGKILFVSESVFKIL
NYSQNDLIGQSLFDYLHPKDIAKVKEQLSSSDTAPRERLIDAKTGLPVKTDITPGPSRLC
SGARRSFFCRMKCNRPSVKVEDKDFPSTCSKKKDRKSFCTIHSTGYLKSWPPTKMGLDED
NEPDNEGCNLSCLVAIGRLHSHVVPQPVNGEIRVKSMEYVSRHAIDGKFVFVDQRATAIL
AYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTREKITTNCYKFKIKDGSFITLRSRWF
SFMNPWTKEVEYIVSTNTVVLANVLEGGDPTFPQLTASPHSMDSMLPSGEGGPKRTHPTV
PGIPGGTRAGAGKIGRMIAEEIMEIHRIRGSSPSSCGSSPLNITSTPPPDASSPGGKKIL
NGGTPDIPSSGLLSGQAQENPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDEAAMA
VIMSLLEADAGLGGPVDFSDLPWPL
Download sequence
Identical sequences ENSNLEP00000021464 ENSNLEP00000021464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]