SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021510 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021510
Domain Number 1 Region: 151-235
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 5.49e-21
Family Thyroglobulin type-1 domain 0.00000988
Further Details:      
 
Domain Number 2 Region: 66-108
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000777
Family Growth factor receptor domain 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021510   Gene: ENSNLEG00000017722   Transcript: ENSNLET00000022601
Sequence length 239
Comment pep:known_by_projection supercontig:Nleu1.0:GL397261.1:59422036:59426533:-1 gene:ENSNLEG00000017722 transcript:ENSNLET00000022601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPHRLLPPLLLLLLALLFAASPGSALARCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAE
AEGCLRREGQECGVYTPNCAPGLQCHPPEDDEAPLRALLLGRGRCLPARAPAVAEENPKE
SKPQAGIARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVY
RGAQTLYVPNCDHRGFYRKRQCRSSRGSARSCWCVDRMGKLPGSPDGNGSSSCPTGSSG
Download sequence
Identical sequences ENSNLEP00000021510 ENSNLEP00000021510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]