SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021789 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021789
Domain Number 1 Region: 374-680
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.55e-54
Family Eukaryotic proteases 0.00064
Further Details:      
 
Domain Number 2 Region: 83-199
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.46e-33
Family Spermadhesin, CUB domain 0.00047
Further Details:      
 
Domain Number 3 Region: 240-310
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000848
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 4 Region: 194-234
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000288
Family EGF-type module 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021789   Gene: ENSNLEG00000017937   Transcript: ENSNLET00000022889
Sequence length 680
Comment pep:known_by_projection supercontig:Nleu1.0:GL397264.1:50115552:50184915:-1 gene:ENSNLEG00000017937 transcript:ENSNLET00000022889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCRECCEYDQIECVCPGKKEVVGYTIPCCRNEENECDSCLIHPGCTIFENCKSCRNGSWG
GTLDDFYVKGFYCAECRAGWYGGDCMRCGQVLRAPKGQILLESYPLNAHCEWTIHAKPGF
VIQLRFVMLSLEFDYMCQYDYVEVRDGDNRDGQIIKRVCGNERPAPIQSTGSSLHVLFHS
DGSKNFDGFHAIFEEITACSSSPCFHDGTCVLDKAGSYKCACLAGYTGQRCENLLEERNC
SDPGGPVNGYQRITGGPGLINGRHAKIGTVVSFFCNNSYVLSGNEKRTCQQNGEWSGKQP
ICIKACREPKISDLVRRRVLPMQVQSRETPLHQLYSAAFSKQKLQSAPTKKPALPFGDLP
MGYQHLHTQLQYECISPFYRRLGSSRRTCLRTGKWSGRAPSCIPICGKIENITAPKTQGL
RWPWQAAIYRRTSGVHDGSLHKGAWFLVCSGALVNERTVVVAAHCVTDLGKVTMIKTADL
KVVLGKFYRDDDRDEKTIQSLRISAIILHPNYDPILLDADIAILKLLDKARISTRVQPIC
LAASRDLSTSFQESHITVAGWNVLADVRSPGFKNDTLRSGVVSVVDSLLCEEQHEDHGIP
VSVTDNMFCASWDPTAPSDICTAETGGIAAVSFPGRASPEPRWHLMGLVSWSYDKTCSHR
LSTAFTKVLPFKDWIERNMK
Download sequence
Identical sequences XP_003254475.1.23891 ENSNLEP00000021789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]