SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000021918 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000021918
Domain Number 1 Region: 404-476
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000366
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000021918   Gene: ENSNLEG00000018041   Transcript: ENSNLET00000023026
Sequence length 766
Comment pep:known_by_projection supercontig:Nleu1.0:GL397296.1:10433737:10816543:-1 gene:ENSNLEG00000018041 transcript:ENSNLET00000023026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIWRSRAGAELFSLMALWEWIALSLHCWVLAVAAVSDQHATSPFDWLLSDKGPFHRSQEY
TDFVDRSRQGFSTRYKIYREFGRWKVNNLAVERRNFLGSPLPLAPEFFRNIRLLGRRPTL
QQITENLIKKYGTHFLLSATLGGEESLTIFVDKRKLSKRAEGSDSSTNSSSVTLETLHQL
AASYFIDRDSTLRRLHHIQIASTAIKVTETRTGPLGCSNYDNLDSVSSVLVQSPENKIQL
QGLQVLLPDYLQERFVQAALSYIACNSEGEFICKENDCWCHCGPKFPECNCPSMDIQAME
ENLLRITETWKAYNGDFEESDEFKLFMKRLPMNYFLNTSTIMHLWTMDSNFQRRYEQLEN
SMKQLFLKAQKIVHKLFSLSKRCHKQPLISLPRQRTSTYWLTRIQSFLYCNENGLLGSFS
EETHSCTCPNDQVVCTAFLPCTVGDASACLTCAPDNRTRCGTCNTGYMLSQGLCKPEVAE
STDHYIGFETDLQDLEMKYLLQKTDRRIEVHAIFISNDMRLNSWFDPSWRKRMLLTLKSN
KYKSSLVHMILGLSLQICLTKNSTLEPVLAVYINPFGGSHSESWFMPVNENSFPDWEQTK
LDLPLQCYNWTLTLGNKWKTFFETVHIYLRSRIKSNGPNGNESIYYEPLEFIDPSRNLGY
MKINNIQVFGYSMHFDPEAIRDLILQLDYPYTQGSQDSALLQLLEIRDRVNKLSPPGQRR
LDLFSCLLRHRLKLSTSEVVRIQSALQAFNAKLPNTMDYDTTKLCS
Download sequence
Identical sequences G1S8S9
XP_003264528.1.23891 ENSNLEP00000021918 ENSNLEP00000021918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]