SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000022028 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000022028
Domain Number 1 Region: 649-844
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.1e-58
Family BCR-homology GTPase activation domain (BH-domain) 0.0000421
Further Details:      
 
Domain Number 2 Region: 466-577
Classification Level Classification E-value
Superfamily PH domain-like 1.6e-19
Family Pleckstrin-homology domain (PH domain) 0.0051
Further Details:      
 
Domain Number 3 Region: 11-94
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000012
Family SH3-domain 0.0014
Further Details:      
 
Domain Number 4 Region: 259-298
Classification Level Classification E-value
Superfamily WW domain 0.00000000994
Family WW domain 0.0022
Further Details:      
 
Domain Number 5 Region: 363-391
Classification Level Classification E-value
Superfamily WW domain 0.0000208
Family WW domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000022028   Gene: ENSNLEG00000018131   Transcript: ENSNLET00000023142
Sequence length 846
Comment pep:known_by_projection supercontig:Nleu1.0:GL397385.1:1050909:1183315:-1 gene:ENSNLEG00000018131 transcript:ENSNLET00000023142 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMADRSGKIIPGQVYIEVEYDYEYEAKDRKIVIKQGERYILVKKTNDDWWQVKPDESSK
AFYVPAQYVKEVTRKALMPPVKQVAGLPNNSTKIMQSLHLQRSTENVNKLPELSSFGKPS
SSVQGTGLIRDANQNFGPSYNPGQTVNLSLDLTHNNGKFNNDSHSPKVSSQNRTRSFGHF
PGPEFLDVEKTSFSQEQSCDSAGEGSERIHQDSESGDELSSSSTEQIRATTPPNQGRPDS
PVYANLQELKISQSALPPLPGSPAIQINGEWETHKDSSGRCYYYNRGTQERTWKPPRWTR
DASISKGDFQNPGDQELLSSEENYYSTSYSQSDSQCGSPPRGWSEELDERGHTLYTSDYT
NEKWLKHVDDQGRQYYYSADGSRSEWELPKYNASSQQQREIIKSRSLDRRLQEPIVLTKW
RHSTIVLDTNDKESPTASKPCFPENESSPSSPKHQDTVSMIEDQEKYGLLNVTKIAENGK
KVRKNWLSSWAVLQGSSLLFTKTQGSSTSWFGSNQSKPEFTVDLKGATIEMASKDKSSKK
NVFELKTRQGTELLIQSDNDTVVNDWFKVLSSTINNQAVETDEGIEEEIPDSPGIEKHDK
EKEQKDPKKLRSFKVSSIDSSEQKKTKKNLKKFLTRRPTLQAVREKGYIKDQVFGSNLAN
LCQRENGTVPKFVKLCIEHVEEHGLDVDGIYRVSGNLAVIQKLRFAVNHDEKLDLNDSKW
EDIHVITGALKMFFRELPEPLFTFNRFNDFVNAIKQEPRQRVAAVKDLIRQLPKPNQDTM
QILFRHLRRVIENGEKNRMTYQSIAIVFGPTLLKPEKETGNIAVHTVYQNQIVELILLEL
SSIFGR
Download sequence
Identical sequences ENSNLEP00000022028 ENSNLEP00000022028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]