SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000022941 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000022941
Domain Number 1 Region: 1-172
Classification Level Classification E-value
Superfamily Cyclophilin-like 9.94e-64
Family Cyclophilin (peptidylprolyl isomerase) 0.000000118
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000022941   Gene: ENSNLEG00000019090   Transcript: ENSNLET00000024115
Sequence length 172
Comment pep:novel supercontig:Nleu1.0:GL397270.1:453575:454093:1 gene:ENSNLEG00000019090 transcript:ENSNLET00000024115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVNPTMFFNMAVNDEPLCHVSFELFADKFPKTAENFRALSTGEKGFGYKCFCFYRIIPGF
MWFMCQGSDFTHHNGTGGKSIYGEKFDDENFILKHTGPELSHPQTNYLSMANAGPNTNGS
QFFICTAKTQWLDGTHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIVDCG
Download sequence
Identical sequences ENSNLEP00000022941 ENSNLEP00000022941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]