SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000023309 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000023309
Domain Number 1 Region: 56-101
Classification Level Classification E-value
Superfamily Immunoglobulin 1.66e-18
Family V set domains (antibody variable domain-like) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000023309   Gene: ENSNLEG00000027064   Transcript: ENSNLET00000032104
Sequence length 101
Comment pep:novel supercontig:Nleu1.0:GL397632.1:322001:323209:-1 gene:ENSNLEG00000027064 transcript:ENSNLET00000032104 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSSPALTLQLWETSSSLGIPNCLHSVISTEYRRLTMEFGLSWVFLVAILKGVQCEVQLV
ESGGGLVQPGGSLRLSCAASGFTFRSSAVHWVRQASGKGLE
Download sequence
Identical sequences ENSNLEP00000023309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]