SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000023547 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000023547
Domain Number 1 Region: 383-654
Classification Level Classification E-value
Superfamily YWTD domain 6.93e-45
Family YWTD domain 0.00000555
Further Details:      
 
Domain Number 2 Region: 78-118
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000017
Family LDL receptor-like module 0.00063
Further Details:      
 
Domain Number 3 Region: 120-156
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000275
Family LDL receptor-like module 0.00047
Further Details:      
 
Domain Number 4 Region: 162-207
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000406
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 5 Region: 40-79
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000012
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 6 Region: 2-37
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000288
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 7 Region: 249-285
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000524
Family LDL receptor-like module 0.0028
Further Details:      
 
Domain Number 8 Region: 294-340
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000104
Family EGF-type module 0.052
Further Details:      
 
Domain Number 9 Region: 204-240
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000209
Family LDL receptor-like module 0.0028
Further Details:      
 
Domain Number 10 Region: 706-741
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000329
Family EGF-type module 0.042
Further Details:      
 
Domain Number 11 Region: 779-814
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000111
Family EGF-type module 0.037
Further Details:      
 
Domain Number 12 Region: 333-369
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000156
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 13 Region: 743-781
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000591
Family EGF-type module 0.04
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000023547
Domain Number - Region: 662-695
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00498
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000023547   Gene: ENSNLEG00000026824   Transcript: ENSNLET00000031922
Sequence length 816
Comment pep:novel supercontig:Nleu1.0:GL397261.1:55590701:55600123:-1 gene:ENSNLEG00000026824 transcript:ENSNLET00000031922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTCGVDEFRCKDSGRCIPARWKCDGEDDCGDGSDEPKEECDERTCEPYQFRCKNNRCVPG
RWQCDYDNDCGDNSDEESCTPRPCSESEFSCANGRCIAGRWKCDGDHDCADGSDEKDCTP
RCDMDQFQCKSGHCIPLRWRCDADADCMDGSDEEACSTGVRTCPLDEFQCNNTLCKPLAW
KCDGEDDCGDNSDENPEECARFVCPPNRPFRCKNDRVCLWIGRQCDGMDNCGDGTDEEDC
EPPTAQTTHCKDKKEFLCRNQRCLSFSLRCNMFDDCGDGSDEEDCSIDPKLTSCATNASI
CGDEARCVRTEKAAYCACRSGFHTVPGQPGCQDINECLRFGTCSQLCNNTKGGHLCSCAR
NFMKTHNTCKAEGSEYQVLYIADDNEIRSLFPGHPHSAYEQAFQGDESVRIDAMDVHVKA
GRVYWTNWHTGTISYRSLPPAAPPTTSNRHRRQIDRGVTHLNISGLKMPRGIAIDWVAGN
VYWTDSGRDVIEVAQMKGENRKTLISGMIDEPHAIVVDPLRGTMYWSDWGNHPKIETAAM
DGTLRETLVQDNIQWPTGLAVDYHNERLYWADAKLSVIGSIRLNGTDPIVAADSKRGLSH
PFSIDVFEDYIYGVTYINNRVFKIHKFGHSPLVNLTGGLSHASDVVLYHQHKQPEVTNPC
DRKKCEWLCLLSPSGPVCTCPNGKRLDNGTCVPVPSPTPPPDAPRPGTCNLQCFNGGSCF
LNARRQPKCRCQPRYTGDKCELDQCWEHCRNGGTCAASPSGMPTCRCPTGFTGPKCTQQV
CAGYCANNSTCTVNQGNQPQCRCLPGFLGDRCQYRE
Download sequence
Identical sequences ENSNLEP00000023547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]