SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000023593 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000023593
Domain Number 1 Region: 4-92
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 1.76e-27
Family MHC antigen-recognition domain 0.000045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000023593   Gene: ENSNLEG00000027030   Transcript: ENSNLET00000031963
Sequence length 133
Comment pep:novel supercontig:Nleu1.0:GL397266.1:41917477:41919586:1 gene:ENSNLEG00000027030 transcript:ENSNLET00000031963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSENGMWTTVHPGARKMKEKWE
NDKDVTKSFYYISMGDCTGWLEDFSVGMDSTLEPSSRAPPTVSSGTTQLRATATTLILCC
LLIILSCFILPGI
Download sequence
Identical sequences ENSNLEP00000023593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]