SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000023630 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000023630
Domain Number 1 Region: 149-242
Classification Level Classification E-value
Superfamily Immunoglobulin 7.32e-25
Family I set domains 0.024
Further Details:      
 
Domain Number 2 Region: 58-153
Classification Level Classification E-value
Superfamily Immunoglobulin 6.27e-21
Family I set domains 0.034
Further Details:      
 
Domain Number 3 Region: 239-324
Classification Level Classification E-value
Superfamily Immunoglobulin 3.91e-20
Family I set domains 0.0076
Further Details:      
 
Domain Number 4 Region: 18-61
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000607
Family V set domains (antibody variable domain-like) 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000023630   Gene: ENSNLEG00000026556   Transcript: ENSNLET00000032004
Sequence length 335
Comment pep:novel supercontig:Nleu1.0:GL397294.1:24469711:24476382:1 gene:ENSNLEG00000026556 transcript:ENSNLET00000032004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGVSVIVRLLLFPVCRESGNSSWEIPRASKAEEGTYECTAVSRAGTGRAKAQIVVTDPPP
QLVPAPNVTVSPGETAVLSCRVLGEAPYNLTWVRDWRVLPASTGRVAQLADLSLEISGII
PTDGGRYQCVASNANGVTRASVWLLVREAPQVSIHSSSQHFSQGVEVKVSCSASGYPTPH
ISWSREGQALQEDSRIHVDAQGTLIIQGVAPEDAGNYSCQATNEVGTDQETVTLYYTDPP
SVSAVNAVVLVAVGEEAVLVCEASGVPPPRVIWYREGLEMILAPEGSSSGKLRIPAAQER
DAGTYTCRAVNELGDASAEIQLAVGRECIPCLPLP
Download sequence
Identical sequences ENSNLEP00000023630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]