SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000023847 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000023847
Domain Number 1 Region: 762-819
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.61e-25
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 846-903
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.9e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 3 Region: 622-679
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.51e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 566-623
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.76e-25
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 902-959
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.47e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 6 Region: 454-511
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.48e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 7 Region: 54-112
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.5e-24
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 8 Region: 958-1015
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.43e-22
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 9 Region: 510-567
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.13e-22
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 10 Region: 286-343
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.03e-21
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 11 Region: 342-399
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.22e-21
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 12 Region: 398-455
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.31e-21
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 13 Region: 706-763
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.36e-19
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 14 Region: 1000-1052
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.49e-18
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 15 Region: 1042-1093
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000987
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 16 Region: 234-285
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000432
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 17 Region: 809-841
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000741
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 18 Region: 669-701
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000656
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 19 Region: 195-244
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000256
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000023847   Gene: ENSNLEG00000026775   Transcript: ENSNLET00000032787
Sequence length 1093
Comment pep:known_by_projection supercontig:Nleu1.0:GL397486.1:702570:741118:-1 gene:ENSNLEG00000026775 transcript:ENSNLET00000032787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWRGLCLSLPREFQVSTSLLCVLCSRRPSLCVFVTCRYWRATAKTPRTPGSLEMGLLTFR
DVAIEFSLEEWQCLDTAQQNLYRNVMLENYRNLAFLGIAVSKPDLITCLEQGKEPWNMKR
HEMVDEPPGVCPHFAQDFWPEQAMEDSFQKVLPRKYEKCGHENLQLRKGCKSVDECKVHK
EGYNKLNQCVTTAQSKVFQCGKYLKVFYKFLNTNRHMIRHTGRKRFKCKKCIKSFCIRLH
KTQHECVYITEKSYKCKECKKTFHWSSTLTNHKKIHTEVKPYKCEAFKQLSTLTTHKIIC
AEEKIYKCEECGKAFLWSSTLTRHKRIHTGEKPYKCEECGKAFRQSSTLTKHKIIHTGET
PYKFEECGKAFRQSLTLTNHKIIHSREKPYKCKECGKAFKQFSTLTTHKIIHAEKKLYKC
EECGKAFNQSSNLSTHKIIHTGEKSYKCEECGKAFLWSSTLTRHKRIHTGEKPCKCEECG
KAFSHSSTLAKHKVIHTGEKPYKCKECGKAFSSSSTLTNHKITHTEEKPYKCKECGKAFK
RLSTLTKHKIIHAGEKLYKCEECGKAFNRSSNLTTHKIIHTGEKPYKCEECGKAFIWSSS
LTKHKRIHTREKPFKCKECGKAFIWSSTLTRHKRIHTGEKPYKCEECDKAFSHSSTLTKH
KTIHTGEKPYKCKECGKAFKHPSTLAKHKIIHAGEKLYKCEECGKAFNQSSNLTTHKIIH
TKEKPSKSKECDKAFIWSSTLTEHKIIHTREKTYKCEECGKAFSQPSHLTTHKRMHTGEK
PYKCEECGKAFSQSSTLTTHKIIHTGEKPYKCEECGKAFRKSSTLTEHKIIHTGEKPYKC
EECGKAFSQSSTLTRHTRMHTGEKPYKCEECGKAFNRSSKLTTHKIIHTGEKPYKCEECG
KAFISSSTLNGHKRIHTREKPYKCEECGKAFSQSSTLTRHKRLHTGEKPYTCGECGKAFK
ESSALTKHKIIHTGEKPYKCEKCGKAFNQSSILTNHKKIHSREKPYKCKECGKSFNRSST
FTKHKVIHTGVKLYKCEECGKSFFWSSALTRHKKIHTGQQPYKQEKFGKAFNQFSHLTAD
KITHIGEKSCKCE
Download sequence
Identical sequences XP_004089302.2.23891 ENSNLEP00000023847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]