SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000024106 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000024106
Domain Number 1 Region: 3-71
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000244
Family I set domains 0.0025
Further Details:      
 
Domain Number 2 Region: 77-127
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000429
Family I set domains 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000024106   Gene: ENSNLEG00000026831   Transcript: ENSNLET00000032479
Sequence length 127
Comment pep:novel supercontig:Nleu1.0:GL397326.1:2318882:2324295:1 gene:ENSNLEG00000026831 transcript:ENSNLET00000032479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVEVSEEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVITN
GGQCEAELIVEEKQLEVLQDIADLTVKASEQAVFKCEVSDEKVTGKWYKNGIEVRPSKRI
TISHVGR
Download sequence
Identical sequences ENSNLEP00000024106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]