SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000024281 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000024281
Domain Number 1 Region: 122-301
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 4.05e-49
Family CRAL/TRIO domain 0.0000387
Further Details:      
 
Domain Number 2 Region: 40-118
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 9.29e-21
Family CRAL/TRIO N-terminal domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000024281   Gene: ENSNLEG00000006612   Transcript: ENSNLET00000032646
Sequence length 342
Comment pep:known_by_projection supercontig:Nleu1.0:GL397262.1:8270498:8284370:1 gene:ENSNLEG00000006612 transcript:ENSNLET00000032646 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEESDSLRTSPSVASLSENELPPPPEPPGYVCSLTEDLVTKAREELQEKPEWRLRDVQA
LRDMVRKEYPNLSTSLDDAFLLRFLRARKFDYDRALQLLVNYHSCRRSWPEVFNNLKPSA
LKDVLASGFLTVLPHTDPRGCHVVCIRPDRWIPSNYPITENIRAIYLTLEKLIQSEETQV
NGIVILADYKGVSLSKASHFGPFIAKKVIGILQDGFPIRIKAVHVVNEPRIFKGIFAIIK
PFLKEKIANRFFLHGSDLNSLHTNLPRSILPKEYGGMAGELDTATWNAVLLASEDDFVKE
FCQPVPACDSILGQTLLPEGLTSDAQCDDSLRAVKSQLYSCY
Download sequence
Identical sequences G1R4C0
XP_003253656.1.23891 XP_003253657.1.23891 ENSNLEP00000008042 ENSNLEP00000024281 ENSNLEP00000008042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]