SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000024340 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000024340
Domain Number 1 Region: 122-217
Classification Level Classification E-value
Superfamily Fibronectin type III 2.64e-21
Family Fibronectin type III 0.0024
Further Details:      
 
Domain Number 2 Region: 206-268
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000614
Family Fibronectin type III 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000024340   Gene: ENSNLEG00000026842   Transcript: ENSNLET00000032703
Sequence length 275
Comment pep:novel supercontig:Nleu1.0:GL397362.1:2680507:2688811:-1 gene:ENSNLEG00000026842 transcript:ENSNLET00000032703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLECAIHFVEIRCYIDNLHFSGRKEWSDWSPVKNISWIPDSQTKVFPQDKVILVGSDIT
FCCVSQEKVLSALIGHTNCPLIHLDGENVAIKIRNISVSASSGTNVVFTTEDNIFGTVIF
AGYPPDTPQQLNCETHDLKEIICSWNPGRATALVGPRATSYTLVESFSGKYVRLKRTEAP
TNESYQLLFQMLPYQEIYNFTLNAHNPLGRSQSTILVNITEKVYPHTPTSFKVKDINSTA
VKLSWHLPGNFAKINFLCQIEIKKSNSVQEQVRFS
Download sequence
Identical sequences ENSNLEP00000024340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]