SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000024391 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000024391
Domain Number 1 Region: 127-512
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.57e-157
Family Myotubularin-like phosphatases 0.000000000011
Further Details:      
 
Domain Number 2 Region: 4-125
Classification Level Classification E-value
Superfamily PH domain-like 4.67e-41
Family GRAM domain 0.0000157
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000024391   Gene: ENSNLEG00000013597   Transcript: ENSNLET00000032753
Sequence length 571
Comment pep:known_by_projection supercontig:Nleu1.0:GL397341.1:7294786:7376254:1 gene:ENSNLEG00000013597 transcript:ENSNLET00000032753 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEAPLFPGESIKAIVKDVMYICPFMGAVSGTLTVTDFKLYFKNVERDPHFILDVPLGVI
SRVEKIGAQSHGDNSCGIEIVCKDMRNLRLAYKQEEQSKLGIFENLNKHAFPLSNGQALF
AFSYKEKFPINGWKVYDPVSEYKRQGLPNESWKISKINSNYEFCDTYPAIIVVPTSVKDD
DLSKVAAFRAKGRVPVLSWIHPESQATITRCSQPLVGPNDKRCKEDEKYLQTIMDANAQS
HKLIIFDARQNSVADTNKTKGGGYESESAYPNAELVFLEIHNIHVMRESLRKLKEIVYPS
IDEARWLSNVDGTHWLEYIRMLLAGAVRIADKIESGKTSVVVHCSDGWDRTAQLTSLAML
MLDSYYRTIKGFETLVEKEWISFGHRFALRVGHGNDNHADADRSPIFLQFIDCVWQMTRQ
FPSAFEFNELFLITILDHLYSCLFGTFLCNCEQQRFKEDVYTKTISLWSYINSQLDEFSN
PFFVNYENHVLYPVASLSHLELWVNYYVRWNPRMRPQMPIHQNLKELLAVRAELQKRVEG
LQREVATRAVSSSSERGSSPSHSAASVHTSV
Download sequence
Identical sequences ENSNLEP00000024391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]