SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000024469 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000024469
Domain Number 1 Region: 292-470
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.31e-66
Family SPRY domain 0.00000466
Further Details:      
 
Domain Number 2 Region: 7-119
Classification Level Classification E-value
Superfamily Immunoglobulin 7.74e-22
Family V set domains (antibody variable domain-like) 0.00028
Further Details:      
 
Domain Number 3 Region: 133-208
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000172
Family C1 set domains (antibody constant domain-like) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000024469   Gene: ENSNLEG00000003228   Transcript: ENSNLET00000032835
Sequence length 496
Comment pep:known_by_projection supercontig:Nleu1.0:GL397291.1:17486840:17497878:1 gene:ENSNLEG00000003228 transcript:ENSNLET00000032835 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FILKAQFTVVGPANPILAMVGENTTLRCHLSPEKNAEDMEVRWFRSQFSPAVFVYKGGRE
RTEEQMEEYRGRITFVSKDIIKGSVALVIHNVTTQENGIYRCYFQEGRSYDEAILRLVVA
GLGSKPLIEIKAQEDGSIWLECISTGWYPEPLTVWRDPYGEVVPTLKEVSIADADGLFMV
TTAVIIRDKYVRNVSCSINNTLLGQEKETVIFIPESFMPSTSPWMVALAVILTASPWMVP
MAVILAVCIIFMAMSICCIKKLQREKKILSGEKEVEQEEKEIAQQLQEELRWRRTFLHAA
DVVLDPETAHPELFLSEDRRSVRRGPCRQRVPDNPERFDSQPCVLGWESFASGKHYWEVE
VENVMVWTVGVCRHSVERKGEVLLIPQNGFWTLEMFGNQYRALSSPERVLPLKESLCRVG
VFLDYEAGDVSFYNMRDRSHIYTCPRSAFTVPVRPFFRLGSDDSPIFICPALTGANGVTV
PEEGLTLHRVGTHQSL
Download sequence
Identical sequences ENSNLEP00000024469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]