SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000024477 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000024477
Domain Number 1 Region: 79-244
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.09e-36
Family Dual specificity phosphatase-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000024477   Gene: ENSNLEG00000016629   Transcript: ENSNLET00000032841
Sequence length 754
Comment pep:known_by_projection supercontig:Nleu1.0:GL397279.1:1791808:1839562:1 gene:ENSNLEG00000016629 transcript:ENSNLET00000032841 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGFLPQNEQPYSTLVNNSECVANRKGNLEHPTPKYTKVGEYLRHVIPGHMWCSMACGG
RACKYENPAHWSEQEQAIKGVYSSWVTDNILAMARPSSELLEKYHIIDQFLSHGIKTIIN
LQRPGEHASCGNPLEQESGFTYLPEAFMEAGIYFYNFGWKDYGVVSLTTILDMVKVMTFA
LQEGKVAIHCHAGLGRTGVLIACYLVFATRMTADQAITSVRAKRPNSIQARGQLLCVREF
TQFLIPLRNIFSCCDPKAHAVTLAQYLIRQRHLLHGYEARLLKHVPKIIHLVCKLLLDLA
ENRPVMMKDVSEGPGLSAEIEKTMSEMVTMQLDKELLRHDSDVSNSPNPTAVAADFNNRG
MIFSKEQESDPLWKRRNVECLQPLTHLKRRLSYSDSDLKRAENLLEQGETPQTVPAQVLV
GHNPRQQKLISHCYIPQSSEPDLHKEALVRSTLSFWSQSKFGGLEGLKDNGSPIFHGRTI
PKEAQQSGAFSADVSGSHSPGEPVSPSFANVHKYPNPAHQQVSHCQCKTHGVGSPGSVRQ
NSRTPRSPLDCGSSPKAQFLVEHETQDSKDLSEAASHSTLQSELSAEARRILAAKALANL
NESVEKEELKRKVEMWQKELNSRDGAWERICGERDPFILCSLMWSWVEQLKEPVITKEDV
DMLVDRRADAAEALFLLEKGQHQTILCVLHCIVNLQTIPVDVEEAFLAHAIKAFTKVNFD
SENGPTVYNTLKKIFKHTLEEKRKMTKDGPKPGL
Download sequence
Identical sequences M3ZCP0
ENSNLEP00000024477 XP_004087059.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]