SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000269 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000269
Domain Number 1 Region: 282-449
Classification Level Classification E-value
Superfamily Cyclophilin-like 6.72e-66
Family Cyclophilin (peptidylprolyl isomerase) 0.0000000159
Further Details:      
 
Domain Number 2 Region: 38-104
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000415
Family U-box 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000269   Gene: ENSNLEG00000000219   Transcript: ENSNLET00000000288
Sequence length 521
Comment pep:novel supercontig:Nleu1.0:GL397544.1:548427:579612:1 gene:ENSNLEG00000000219 transcript:ENSNLET00000000288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKRQHQKDKMYITCAEYTHFYGGKKPDLPQTNFRRLPFDHCSLSLQPFVYPVCTPDGVV
FDLLNIVPWLKKYGTNPSNGEKLDGRSLIKLNFAKNSEGKYHCPVLFTVFTNNTHIVAVR
TTGNVYAYEVLQPPHFQAGQKKALASSAPLTAGRILFLPQDPTNLDKFNVSNFYHVKNNM
KIIDPDEEKAKQDPSYYLKNTNAETRETLQELYKEFKGDEILAATMKVPEKKKVDKLNAA
HYSTGKVSASFTSTAMVPETTHEAAAIDEDVLRYQFVKKKGYVRLHTNKGDLNLELHCDL
TPKTCENFIRLCKKHYYDGTIFHRSIRNFVIQGGDPTGTGTGGESYWGKPFKDEFRPNLS
HTGRGILSMANSGPNSNKSQFFITFRSCAYLDKKHTIFGRVVGGFDVLTAMENVESDPKT
DRPKEEIRIDATTVFVDPYEEADAQIAQERKTQLEVAPETKVKSSQPQAGSQGPQTFRQG
VGKYINPAATKRAAEEEPSTSATVPMSKKKPSRGFGDFSSW
Download sequence
Identical sequences ENSNLEP00000000269 ENSNLEP00000000269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]