SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000331 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000331
Domain Number 1 Region: 280-576
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.73e-90
Family Protein kinases, catalytic subunit 0.000000019
Further Details:      
 
Domain Number 2 Region: 102-229
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.12e-36
Family Synaptotagmin-like (S variant) 0.00000106
Further Details:      
 
Domain Number 3 Region: 43-99
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.39e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00015
Further Details:      
 
Domain Number 4 Region: 3-33
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000244
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000331   Gene: ENSNLEG00000000267   Transcript: ENSNLET00000000355
Sequence length 617
Comment pep:novel supercontig:Nleu1.0:GL397319.1:445631:948252:-1 gene:ENSNLEG00000000267 transcript:ENSNLET00000000355 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFRGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFC
DHCGSLLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVADEKLHV
TVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSD
KDRRLSVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDE
EGNMELRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVML
ADRKGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYF
VMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEG
HIKIADFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQ
PPFDGEDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPAKRLGCGPEGERDVREHA
FFRRIDWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEG
FSYVNPQFVHPILQSAV
Download sequence
Identical sequences G7NJA9 G7PV75
ENSNLEP00000000331 ENSNLEP00000000331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]