SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000332 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000332
Domain Number 1 Region: 58-423,663-1066,1096-1119,1228-1272
Classification Level Classification E-value
Superfamily ARM repeat 3.84e-41
Family Armadillo repeat 0.049
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000000332
Domain Number - Region: 1-52
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000262
Family beta-sandwich domain of Sec23/24 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000332   Gene: ENSNLEG00000000273   Transcript: ENSNLET00000000356
Sequence length 2722
Comment pep:novel supercontig:Nleu1.0:GL397450.1:1452384:1621830:1 gene:ENSNLEG00000000273 transcript:ENSNLET00000000356 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QQQQQQQQQQPPPPPPPPPLSFQPPPQAQPLLQPQPPPPPPPPPPGPAVAEEPLHRPKKE
LSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECL
NKVIKALMDSNLPRLQLELYKEIKKNGAPRSLRAALWRFAELAHLVRPQKCRPYLVNLLP
CLTRTSKRPEESVQETLAAAVPKIMASFGNFANDNEIKVLLKAFIANLKSSSPTIRRTAA
GSAVSICQHSRRTQYFYSWLLNVLLGLLVPVEDEHSTLLILGVLLTLRYLVPLLQQQVKD
TSLKGSFGVTRKEMEVSPSAEQLVQVYELTLHHTQHQDHNVVTGALELLQQLFRTPPPEL
LQTLTTVGGIGQLTAAKEQSGGRSRSGSIVELIGNRGSSCSPVLSRKQKGKVLLGEEEAL
EDDSESRSDVSSSALAASVKDEISGELAASSGVSTPGSAGHDIITEQPRSQHTLQADSVD
LAGCDLTSSATDGDEEDILSHSSSQVSAVPSDPAMDLNDGTQASSPISDSSQTTTEGPDS
AITPSDSSEIVLDGTDNQYLGLQIGQPQDEDEEATGILPDEASEAFRNSSMALQQAQLLK
NTSHSRQPSDSSVDKFVLRDEATELGDQENKPCRVKGDIGQSTDDDSAPLVHCVRLLSAS
FLLTGGKNVLVPDRDVRVSVKALALSCVGAAVALHPESFFSKLYKVPLDTTEYPEEQYVS
DILNYIDHGDPQVRGATAILCGTLICSILSRSRFHVGDWMGTIRTLTGNTFSLADCIPLL
RKTLKDESSVTCKLACTAVRHCVMSLCSSSYSELGLQLIIDVLTLRNSSYWLVRTELLET
LAEIDFRLVSFLEAKAENLHRGAHHYTGLLKLQERVLHNVVIHLLGDEDPRVRHVAAASL
IRLVPKLFYKCDQGQADPVVAVARDQSSVYLKLLMHETQPPSHFSVSTITRIYRGYNLLP
SITDVTMENNLSRVIAAVSHELITSTTRALTFGCCEALCLLSTAFPVCIWSLGWHCGVPP
LSASDESRKSCTVGMATMILTLLSSAWFPLDLSAHQDALILAGNLLAASAPKSLRSSWAS
EEEANPAATKQEEVWPALGDRALVPMVEQLFSHLLKVINICAHVLDDVAPGPAIKAALPS
LTNPPSLSPIRRKGKEKEPGEQASVPLSPKKGSEASAASRQSDTSGPVITSKSSSLGSFY
HLPSYLKLHDVLKATHANYKVTLDLQNSTEKFGGFLRSALDVLSQILELATLQDIGKCVE
EILGYLKSCFSREPMMATVCVQQLLKTLFGTNLASQFDGLSSNPSKSQGRAQRLGSSSVR
PGLYHYCFMAPYTHFTQALADASLRNMVQAEQEHDTSGWFDVLQKVSTQLKTNLTSVTKN
RADKNAIHNHIRLFEPLVIKALKQYTTTTSVQLQKQVLDLLAQLVQLRVNYCLLDSDQVF
IGFVLKQFEYIEVGQFRESEAIIPNIFFFLVLLSYERYHSKQIIGIPKIIQLCDGIMASG
RKAVTHVCPSLRAWWHDLGSLQAPPPGDPPALASQSARITGMSHQLLGWVGVLERNVICP
AAVHKENEDKWKRLSRQIADIILPMLAKQQMHIDSHEALGVLNTLFEILAPSSLRPVDML
LRSMFVTPNTMASVSTVQLWISGILAILRVLISQSTEDIVLSRIQELSFSPYLISCPVIN
RLRDGDCNSVLEEHSEGKQMKNLPEETFSRFLLQLVGILLEDIVTKQLKVEMSEQQHTFY
CQELGTLLMCLIHIFKSGMFRRITAAATRLFRSDGCGGSFYTLDSLNLRARSMITTHPAL
VLLWCQILLLVNHTDYRWWAEVQQTPKRHSLSSTKLLSPQMSGEEEDSDLAAKLGMCNRE
IVRRGALILFCDYVCQNLHDSEHLTWLIVNHIQDLISPPRAPVQNFISAVHRKLCCQRLF
IQTIQSRCENLSTPTTLKKTLQCLEGIHLSQSGAVLTLYVDRLLCTPFRVLARMVDILAC
RRVEMLLAANLQSSMAQLPMEELNRIQEYLQSSGLAQRHQRLYSLLDRFRLSTMQDSLSP
SPPVSSHPLDGDGHVSLETVSPDKDWYIHLVKSQCWTRSDSALLEGAELVNRIPAEDMSA
FMMNSEFNLSLLAPCLSLGMSEISGGQKSPLFEAAREVTLARVSGTVQQLPAVHHVFQPD
LPAEPAAYWSKLNDLFGDAALYQSLPTLARALAQYLVVVSKLPSHLHLPPEKEKDIVKFV
VATLEALSWHLIREQIPLSLDLQAGLDCCCLALQLPGLWSVVSSTEFVTHACSLIHCVHF
ILEAVAVQPGEQLLSPERRTNTPKAIREEEEEVDPNTQNPKYITAACEMVAEMVESLQSV
LALGHKRNSGVPAFLTSVLRNIIISLARLPLVNSYTRVPPLVWKLGWSPKPGGDFGTAFP
EIPVEFLQEKEVFKEFIYRINTLGWTSRTQFEETWATLLGVLVTQPLVMEQEESPPEEDT
ERTQINVLAVQAITSLVLSAMTVPVAGNPAVSCLEQQPRNKPLKALDTRFGRKLSIIRGI
VEQEIQAMVSKRENIATHHLYQAWDPVPSLSPATTGALISHEKLLLQINPERELGSMSYK
LGQVSIHSMWLGNSITPLREEEWDEEEEEEADAPAPSSPPTSPVNSRKHRAGVDIHSCSQ
FLLELYSRWILPSSSARRTPAILISEVVRSLLVVSDLFTERNQFELMYVTLTELRRVHPS
EDEILAQYLVPATCKAAAVLGM
Download sequence
Identical sequences ENSNLEP00000000332 ENSNLEP00000000332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]