SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000417 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000417
Domain Number 1 Region: 211-311
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.09e-28
Family Ras-binding domain, RBD 0.00000224
Further Details:      
 
Domain Number 2 Region: 4-104
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.15e-22
Family Ras-binding domain, RBD 0.015
Further Details:      
 
Domain Number 3 Region: 963-1060
Classification Level Classification E-value
Superfamily PDZ domain-like 4.21e-22
Family PDZ domain 0.0000272
Further Details:      
 
Domain Number 4 Region: 370-466
Classification Level Classification E-value
Superfamily SMAD/FHA domain 3.31e-21
Family FHA domain 0.00000265
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000000417
Domain Number - Region: 1331-1421
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0785
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000417   Gene: ENSNLEG00000000333   Transcript: ENSNLET00000000443
Sequence length 1766
Comment pep:novel supercontig:Nleu1.0:GL397580.1:206800:313768:1 gene:ENSNLEG00000000333 transcript:ENSNLET00000000443 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLEFHGVMRFYFQDKAAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYE
VHVSGERRLDIDEKPLVVQLNWNKDDREGRFVLKNENDAIPPKAQSNGPEKQEKEGVIQN
FKRTLSKKEKKEKKKREKEALRQASDKDDRPFQGEDVENSRLAAEVYKDMPETSFTRTIS
NPEVVMKRRRQQKLEKRMQEFRSSDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDPADF
AVAEALEKYGLEKENPKDYCIARVMLPPGAQHSDEKGAKEIILDDDECPLQIFREWPSDK
GILVFQLKRRPPDHIPKKTKKHLEGKTPKGKERADGSGYGSTLPPEKLPYLVELSPGRRN
HFAYYNYHTYEDGSDSRDKPKLYRLQLSVTEVGTEKLDDNSIQLFGPGIQPHHCDLTNMD
GVVTVTPRSMDAETYVEGQRISETTMLQSGMKVQFGASHVFKFVDPSQDHALAKRSVDGG
LMVKGPKHKPGIVQETTFDLGGDIHSGTALPTSKSTTRLDSDRVSSASSTAERGMVKPMI
RVEQQPDYRRQESRTQDASGPELILPASIEFRESSEDSFLSAIINYTNSSTVHFKLSPTY
VLYMACRYVLSNQYRPDISPTERTHKVIAVVNKMVSMMEGVIQKQKNIAGALAFWMANAS
ELLNFIKQDRDLSRITLDAQDVLAHLVQMAFKYLVHCLQSELNNYMPAFLDDPEENSLQR
PKIDDVLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNRLVTDPDSGLCSHYWG
AIIRQQLGHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYAPDDIPNINSTCFKLNSL
QLQALLQNYHCAPDEPFIPTDLIENVVAVAENTADELARSDGREVQLEEDPDLQLPFLLP
EDGYSCDVVRNIPNGLQEFLDPLCQRGFCRLIPHTRSPGTWTIYFEGADYESHLLRENTE
LAIPLRKEPEIITVTLKKQNGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAAGD
QLLSVDGRSLVGLSQERAAELMTRTSSVVTLEVAKQGAIYHGLATLLNQPSPMMQRISDR
RGSGKPRPKSEGFELYNNSTQNGSPESPQLPWAEYSEPKKLPGDDRLMKNRADHRSSPNV
ANQPPSPGGKSAYASGTTAKITSVSTGNLCTEEQTPPPRPEAYPIPTQTYTREYFTFPAS
KSQDRMAPPQNQWPNYEEKPHMHTDSNHSSIAIQRVTRSQEELREDKAYQLERHRIEAAM
DRKSDSDMWINQSSSLDSSTSSQEHLNHSSKSVTPASTLTKSGPGRWKTPAAIPATPVAV
SQPIRTDLPPPPPPPPVHYAGDFDGMSMDLPLPPPPSANQIGLPSAQVAAAERKKREEHQ
RWYEKEKARLEEERERKRREQERKLGQMRTQSLNPAPFSPLTAQQMKPEKPSTLQRPQET
VIRELQPQQQPRTIERRDLQYITSVVLYLSHQVVETQMTRDTSMEEIDPVSYRAGESQGL
QTHRGRDLAIENSTPDLSDSVIYFKIVELKKCKKFYLPTVSLTWYFLQDEERRRQQQLEE
MRKREAEDRARQEEERRRQEEERTKRDAEEKRRQEEGYYSRLEAERRRQHDEAARRLLEP
EAPGLCRPPLPRDYEPPSPSLAPGAPPPPPQRNASYLKTQVLSPDSLFTAKFVAYNEEEE
EEDCSLAGPNSYPGSTGAAVGAHDAYRDAKEKRSKSQDADSPGSSGAPENLTFKERQRLF
SQGQDVSNKVKASRKLTELENELNTK
Download sequence
Identical sequences ENSNLEP00000000417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]