SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000441 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000441
Domain Number 1 Region: 178-316
Classification Level Classification E-value
Superfamily PH domain-like 3.07e-22
Family Third domain of FERM 0.0095
Further Details:      
 
Domain Number 2 Region: 60-130
Classification Level Classification E-value
Superfamily Second domain of FERM 1.05e-18
Family Second domain of FERM 0.0045
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000000441
Domain Number - Region: 11-60
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0543
Family First domain of FERM 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000441   Gene: ENSNLEG00000000364   Transcript: ENSNLET00000000469
Sequence length 479
Comment pep:novel supercontig:Nleu1.0:GL397580.1:380457:391769:-1 gene:ENSNLEG00000000364 transcript:ENSNLET00000000469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTALMKAFVLLSDNEYIFMDLEQKLSKYFSKDWKKEINEGNEKPRAPFVAFLRVQHYVE
NGRVISDHRARHLYYCHLKERVLRSQCTHREEAYFLLAACALQADLGEHQEPAHAGRYFE
PHSYFPQWVRVRDGNRAITCPLLLKARGSLPPPKAGAWSMEASAPSQTDHTLPSDKKEGC
PTVILGLALRGVHIYQEVDRAPQLLYDLPWPHIGKLAFLGKKLEIQLDGLPAAQKLVYYT
GCTWRSRHLLHLLCASHQLHLRVRPTLQQLRQREEAEEKQRYRESYISDGLELDPASRSS
PGSGVSSQHCPHCLSHHSANSHGSSYTSGIKADSWLRESREMSVDVPLEVHGLREKEPSS
SPRTSRSHPSTRGDSQATRQEPCAKVRTRGQSAKAMRQIQEMKAGVSEEQHSCSLDDMSL
HQLALHPAPASLRHTFHWALDCRLTGPCEIRATPLPSKGSSNCLAPDLFREAPPQEFVV
Download sequence
Identical sequences ENSNLEP00000000441 ENSNLEP00000000441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]