SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000713 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000713
Domain Number 1 Region: 1679-1969
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.7e-71
Family Protein kinases, catalytic subunit 0.00000108
Further Details:      
 
Domain Number 2 Region: 286-465
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.49e-52
Family DBL homology domain (DH-domain) 0.0000000134
Further Details:      
 
Domain Number 3 Region: 923-1120
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.58e-51
Family DBL homology domain (DH-domain) 0.0000147
Further Details:      
 
Domain Number 4 Region: 472-592
Classification Level Classification E-value
Superfamily PH domain-like 4.56e-34
Family Pleckstrin-homology domain (PH domain) 0.00000213
Further Details:      
 
Domain Number 5 Region: 1121-1238
Classification Level Classification E-value
Superfamily PH domain-like 1.94e-31
Family Pleckstrin-homology domain (PH domain) 0.00062
Further Details:      
 
Domain Number 6 Region: 1508-1669
Classification Level Classification E-value
Superfamily Fibronectin type III 1.66e-24
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 7 Region: 104-241
Classification Level Classification E-value
Superfamily Spectrin repeat 5.5e-18
Family Spectrin repeat 0.0069
Further Details:      
 
Domain Number 8 Region: 1328-1391
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000522
Family SH3-domain 0.0000302
Further Details:      
 
Domain Number 9 Region: 651-716
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000197
Family SH3-domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000713   Gene: ENSNLEG00000000523   Transcript: ENSNLET00000000759
Sequence length 1992
Comment pep:novel supercontig:Nleu1.0:GL397380.1:2531211:3168507:1 gene:ENSNLEG00000000523 transcript:ENSNLET00000000759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDRLKLVNASVAFYKTSEQVCSVLESLEQEYRRDEDWCGGRDKLGPAAEIDHVIPLISK
HLEQKEAFLKACTLARRNAEVFLKYIHRNNVSMPSVASHTRGPEQQVKAILSELLQRENR
VLHFWTLKKRRLDQCQQYVVFERSAKQALDWIQETGEFYLSTHTSTGETTEETQELLKEY
GEFRVPAKQTKEKVKLLIQLADSFVEKGHIHATEIRKWVTTVDKHYRDFSLRMGKYRYSL
EKALGVNTEDNKDLELDIIPASLSDREVKLRDANHEVNEEKRKSARKKEFIMAELLQTEK
AYVRDLHECLETYLWEMTSGVEEIPPGILNKEHIIFGNIQEIYDFHNNIFLKELEKYEQL
PEDVGHCFVTWADKFQMYVTYCKNKPDSNQLILEHAGTFFDEIQQRHGLANSISSYLIKP
VQRITKYQLLLKELLTCCEEGKGELKDGLEVMLSVPKKANDAMHVSMLEGFDENLDVQGE
LILQDAFQVWDPKSLIRKGRERHLFLFEISLVFSKEIKDSSGHTKYVYKNKLLTSELGVT
EHVEGDPCKFALWSGRTPSSDNKTVLKASNIETKQEWIKNIREVIQERIIHLKGALKEPL
QLPKTPAKQRNNSKRDGVEDIDSQGDGSSQPDTISIASRTSQNTVDSDKLSGGCELTVVL
QDFSAGHSSELTIQVGQTVELLERPGERPGWCLVRTTERSPPLEGLVPSSALCISHSRSS
VEMDCFFPLVKGRRTERGAGAGGSQQSVAQLQLQSSFTLINSSSAPELRPAQAAAHSNVV
EFRLNSGKADGNIKKQKKVRDGRKSFDLGSPKPGDETTPQGDSADEKSKKGWGEDEPDEE
SHTPLPPPMKIFDNDPTQDEMSSSLLAARQASTEVPTAADLVNAIEKLVKNKLSLEGGSY
RGSLKDPAGCLNEGMAPPTPPRNPEEEQKAKALRGRMFVLNELVQTEKDYVKDLGIVVEG
FMKRIEEKGVPEDMRGKDKIVFGNIHQIYDWHKDFFLAELEKCIQEQDRLAQLFIKHERK
LHIYVWYCQNKPRSEYIVAEYDAYFEEVKQEINQRLTLSDFLIKPIQRITKYQLLLKDFL
RYSEKAGLECSDIEKAVELMCLVPKRCNDMMNLGRLQGFEGTLTAQGKLLQQDTFYVIEL
DAGMQSRTKERRVFLFEQIVIFSELLRKGSLTPGYMFKRSIKMNYLVLEENVDNDPCKFA
LMNRETSERVILQAANADIQQAWVQDINQVLETQRDFLNALQSPIEYQRKERSAAVMRSQ
PARLPQASPRPYSSVPVGSEKPPKGSSYNPPLPPLKISTSNGSPGFEYHQPEDKFEASKQ
NDLGGCNGTSSMAVIKDYYALKENEICVSQGEVVQVLAVNQQNMCLVYQPASDHSPAAEG
WVPGSILAPLTKATAAESSDGSIKKSCSWHTLRMRKRAEVENTGKNEATGPRKPKDILGN
KVSVKETNSSEESECDDLDPNTSMEILNPNFIQEVAPEFLVPLVDVTCLLGDTVILQCKV
CGRPKPTITWKGPDQNILDTDNSSATYTVSSCDSGEITLKICNLMPQDSGIYTCIATNDH
GTTSTSATVKVQGVPAAPNRPIAQERSCTSVILRWLPPSSTGNCTISGYTVEYREEGSQI
WQQSVASTLDTYLVIEDLSPGCPYQFRVSASNPWGISLPSEPSEFVRLPEYDAAADGATI
SWKENFDSAYTELNEIGRGRFSIVKKCIHKATRKDVAVKFVSKKMKKKEQAAHEAALLQH
LQHPQYITLHDTYESPTSYILILELMDDGRLLDYLMNHDELMEEKVAFYIRDIMEALQYL
HNCRVAHLDIKPENLLIDLRIPVPRVKLIDLEDAVQISGHFHIHHLLGNPEFAAPEVIQG
IPVSLGTDIWSIGVLTYVMLSGVSPFLDESKEETCINVCRVDFSFPHEYFCGVSNAARDF
INVILQEDFRRRPTAATCLQHPWLQPHNGSYSKIPLDTSRLACFIERRKHQNDVRPIPNV
KSYIVNRVNQGT
Download sequence
Identical sequences ENSNLEP00000000713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]