SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000749 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000749
Domain Number 1 Region: 643-813
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.2e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.0000727
Further Details:      
 
Domain Number 2 Region: 81-283
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-43
Family DBL homology domain (DH-domain) 0.0004
Further Details:      
 
Domain Number 3 Region: 299-343,426-460
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000247
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 
Domain Number 4 Region: 503-609
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000000234
Family Synaptotagmin-like (S variant) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000749   Gene: ENSNLEG00000000612   Transcript: ENSNLET00000000795
Sequence length 859
Comment pep:novel supercontig:Nleu1.0:GL397491.1:952083:1159301:-1 gene:ENSNLEG00000000612 transcript:ENSNLET00000000795 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPLSHRGLPRLSWIDTLYSNFSYGTDEYDGEGNEEQKGPPEGSETMPYIDESPTMSPQL
SARSQGGGDGVSPTPPEGLAPGVEAGKGLEMRKLVLSGFLASEEIYINQLEALLLPMKPL
KATATTSQPVLTIQQIETIFYKIQDIYEIHKEFYDNLCPKVQQWDSQVTMGHLFQKLASQ
LGVYKAFVDNYKVALETAEKCSQSNNQFQKISEELKVKGPKDSKDSHTSVTMEALLYKPI
DRVTRSTLVLHDLLKHTPVDHPDYPLLQDALRISQNFLSSINEDIDPRRTAVTTPKGETR
QLVKDGFLVEVSESSRKLRHVFLFTDVLLCAKLKNTSAGKKKKKKGKGGVREGGRTLPPM
EPSATFPQVHPFPDHELEDMKMKISALKSEIQKEKANKGQSRAIERLKKKMFENEFLLLL
NSPTIPFRIHNRNGKSYLFLLSSDYERSEWREAIQKLQKKDLQAFVLSSVELQVLTGSCF
KLRTVHNIPVTSNKDDDESPGLYGFLHVIVHSAKGFKQSANLYCTLEVDSFGYFVSKAKT
RVFRDTAEPKWDEEFEIELEGSQSLRILCYEKCYDKTKVNKDNNEIVDKIMGKGQIQLDP
QTVETKNWHTDVIEMNGIKVEFSMKFTSRDMSLKRTPSKKQTGVFGVKISVVTKRERSKV
PYIVRQCVEEVEKRGIEEVGIYRISGVATDIQALKAVFDANNKDILLMLSDMDINAIAGT
LKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKENCMMHLLRSLPDPNLITFLFLLEHLK
RVAEKEPINKMSLHNLATVFGPTLLRPSEVESKAHLTSAADIWSHDVMAQVQVLLYYLQH
PPISFAELKRNTLYFSTDV
Download sequence
Identical sequences ENSNLEP00000000749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]