SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000754 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000754
Domain Number 1 Region: 652-833
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.72e-48
Family ATP-dependent protease Lon (La), catalytic domain 0.00000557
Further Details:      
 
Domain Number 2 Region: 324-573
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.44e-45
Family Extended AAA-ATPase domain 0.0043
Further Details:      
 
Domain Number 3 Region: 12-218
Classification Level Classification E-value
Superfamily PUA domain-like 1.81e-18
Family LON domain-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000754   Gene: ENSNLEG00000000605   Transcript: ENSNLET00000000800
Sequence length 850
Comment pep:novel supercontig:Nleu1.0:GL397289.1:435193:608234:1 gene:ENSNLEG00000000605 transcript:ENSNLET00000000800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSVSPIQIPSRLPLLLTHEGVLLPGSTMRTSVDSARNLQLVRSRLLKGTSLQSTILGVI
PNTPDPASDAQDLPPLHRIGTAALAVQVVGSNWPKPHYTLLITGVCRFQIVQVLKEKPYP
IAEVEQLDRLEEFPNTCKMREELGELSEQFYKYAVQLVEMLDMSVPAVAKLRRLLDSLPR
EALPDILTSIIRTSNKEKLQILDAVSLEERFKMTIPLLVRQIEGLKLLQKTRKPKQDDDK
RVIAIRPIRRITHISGTLEDEDEDNDDIVMLEKKIRTSSMPEQAHKVCVKEIKRLKKMPQ
SMPEYALTRNDLEPMVELPWNKSTTDRLDIRAARILLDNDHYAMEKLKKRVLEYLAVRQL
KNNLKGPILCFVGPPGVGKTSVGRSVAKTLGREFHRIALGGVCDQSDIRGHRRTYVGSMP
GRIINGLKTVGVNNPVFLLDEVDKLGKSLQGDPAAALLEVLDPEQNHNFTDHYLNVAFDL
SQVLFIATANTTATIPAALLDRMEIIQVPGYTQEEKIEIAHRHLIPKQLEQHGLTPQQIQ
IPQVTTLDIITRYTREAGVRSLDRKLGAICRAVAVKVAEGQHKEAKLDRSDVTEREGCRE
HILEDEKPESISETTDLALPPEMPILIDFHALKDILGPPMYEMEVSQRLSQPGVAIGLAW
TPLGGEIMFVEASRMDGEGQLTLTGQLGDVMKESAHLAISWLRSNAKKYQLTNAFGSFDL
LDNTDIHLHFPAGAVTKDGPSAGVTIVTCLASLFSGRLVRSDVAMTGEITLRGLVLPVGG
IKDKVLAAHRAGLKQVIIPRRNEKDLEGIPGNVRQDLSFVTASCLDEVLNAAFDGGFTVK
TRPGLLNSKL
Download sequence
Identical sequences G1QIL1
ENSNLEP00000000754 XP_003263075.1.23891 ENSNLEP00000000754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]