SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000850 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000850
Domain Number 1 Region: 507-530,570-668
Classification Level Classification E-value
Superfamily PH domain-like 1.28e-29
Family Pleckstrin-homology domain (PH domain) 0.0048
Further Details:      
 
Domain Number 2 Region: 674-801
Classification Level Classification E-value
Superfamily PH domain-like 8.22e-20
Family Pleckstrin-homology domain (PH domain) 0.008
Further Details:      
 
Domain Number 3 Region: 1088-1220
Classification Level Classification E-value
Superfamily Second domain of FERM 5.36e-19
Family Second domain of FERM 0.0056
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000000850
Domain Number - Region: 989-1066
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000482
Family Ubiquitin-related 0.055
Further Details:      
 
Domain Number - Region: 37-128,575-595
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000649
Family BAR domain 0.028
Further Details:      
 
Domain Number - Region: 1224-1282
Classification Level Classification E-value
Superfamily PH domain-like 0.00533
Family Third domain of FERM 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000850   Gene: ENSNLEG00000000704   Transcript: ENSNLET00000000906
Sequence length 1359
Comment pep:novel supercontig:Nleu1.0:GL397292.1:1851618:1896772:1 gene:ENSNLEG00000000704 transcript:ENSNLET00000000906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELKVDAPASVDWQKRCLTLETQLFRFRLQASKIRELLADKMQELEQRLLEAEQRAENA
ETQVGVMEEKVKLSNLKNVDSEGSLHQKYQELLKAIKGKDELISQLEAQLEKQKRMRAEE
AKTVQEKAAKIKEWVTLKLAELEMENQHLKSRNQHLVEQVGALQDALEAIQIAPSQKLLV
PPHGAAEQDSVPSEPGIQPMGQDSGSQAQGLKAAVLAPSPGALQSKDSVSEAASPLEDSS
SSTVHSGETVEAKPLQPHLGRESPPHQPCMKLRTFRCGSASWGESLVTAERGMLPGTKTS
AREGGPGSSLTLPKVRAPGTPRDSIQLAKRHHSQPQVGRGHFDRVVSIEIGAFSSLHPSG
LPELESRARYREEPEKMEMEEPPPAGKNEERDSPALGAELEEVELGNKPPTPPLHQFSSW
KSRIYAVATSGMRLSDVSPRSNSACCVTSSPPALASPGSFSGLVYKNVTVPVYTALKGVR
NCCTNRGPLDSSSNDCAQHVSFYFIVPSGWSRLSSSGLRESGRCVSMSSLSSEGDYAIPP
DACSLDSDYSEPEHKLQRTSSYSTDGLGLGGESLEKSGYLLKMGSRVKTWKRRWFVLRQG
QIMYYKSPSDVIRKPQGQVDLNSHCQIVRGEGSQTFQLISEKKTYYLTADSPSLLEEWIR
VLQSLLKVQATGPPALPRGGTKPTVKGWLTKVKHGHSKLVWCALVGKTFYYYRNHEDKRP
LGCLPVRDARIEEVDRSCDSDEDYEAGGTRRLLSSHCTLVIHPTEHSPTYLLIGTKHEKD
TWLYHLTVAAGGSSAKVGTAYEQLIGKLMDGEGDPDSPLWRHPMLCYSKDGLYASLTTLP
SEALQTEALKLFKSCQLFINVPVEAASVDYHVSLAQTALQVCLVHPELQSEIYCQLMKQT
SCRPPQKYSLMQCWQLLALCAPLFLPQHHFLWYVKQQLQRHADPRSETGQYATYCQRAVE
RTLRTGEREARPSRMEVVSILLRNPFHHSLPFSIPVHFTNGTYQVVGFDGSSTVDEFLQR
LNQEIGMRKPSHSGFALFTDDPSGRDLEHCLQGSVKICDAISKWEQAMKELHSGKSEGGT
RVVKLMYKNRLYFRSQVKGETDRERLLLASQTSREIVAGRFPVNKELALEMAALMAQVEY
GDLEKPALPGPGGTSPAKAQHLLQQVLDRFYPRRYRHGAPLEQLRHLADMLTTKWATLQG
CSPPECIRIYLTVARKWPFFGAKLFAAQPAQLSSKEHALVWIAVNEDGVSILDHNTMQVH
VTYPYSSVTTFGGCRDDFMLVIRSIPDKSSGKSHIEKLIFRMAAPKIAEATFIMASYMNH
CTTTVNPPTNPPGACQLWELDGQQFFSSVSCATKGPTLL
Download sequence
Identical sequences ENSNLEP00000000850 ENSNLEP00000000850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]