SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000854 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000854
Domain Number 1 Region: 445-574
Classification Level Classification E-value
Superfamily eIF1-like 1.83e-19
Family eIF1-like 0.007
Further Details:      
 
Domain Number 2 Region: 375-475
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 6.32e-17
Family SWIB/MDM2 domain 0.011
Further Details:      
 
Domain Number 3 Region: 94-181
Classification Level Classification E-value
Superfamily PUA domain-like 0.000000000000168
Family PUA domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000854   Gene: ENSNLEG00000000648   Transcript: ENSNLET00000000910
Sequence length 584
Comment pep:novel supercontig:Nleu1.0:GL397352.1:564810:585868:-1 gene:ENSNLEG00000000648 transcript:ENSNLET00000000910 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFAKAFRVKSNTAIKGSDRRKLRADVTTAFPTLGTDQVSELVPGKEELNIVKLYAHKGDA
VTVYVSGGNPILFELEKNLYPTVYTLWSYPDLLPTFTTWPLVLEKLVGGADLMLPGLVMP
PSGLPQVQKGDLCAISLVGNRAPVAIGVAAMSTAEMLTSGLKGRGFSVLHTYQDHLWRSG
NKSSPPSIAPLALDSADLSEEKGSVQVDSTLQRDMRHMTLEGEEENGEVHQACEDKSLSE
ASEDTSTGGLNQDSTDSKTLQEQMDELLQQCFLHALKCRVKKADLPLLTSTFLGSHMFSC
CPEGRQLDIKKSSYKKLSKFLQQMQQEQIIQVKELSKGVESIVAVDWKHPRITSFVIPEP
SPTSQTIQEGSREQPYHPPDIKPLYCVPASMTLLFQESGHKKGSFLEGSEVRTIVINYAK
KNDLVDADNKNLVKLDPILCDCILEKNEQHTVMKLPWDSLLTRCLEKLQPAYQVTFPGQE
PIVKKGRICPIDITLAQRASNKKVTVVRNLEAYGLDPYSVAAILQQRCQASTTVTPAPGA
KDSLQVQIQGNQVHHLGWLLLEDYQLPRKHIQGLEKAPKPGKKK
Download sequence
Identical sequences G1QIW0
ENSNLEP00000000854 ENSNLEP00000000854 XP_003273006.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]