SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000924 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000924
Domain Number 1 Region: 315-388
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000188
Family SH3-domain 0.0019
Further Details:      
 
Domain Number 2 Region: 97-162
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000994
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000924   Gene: ENSNLEG00000000789   Transcript: ENSNLET00000000982
Sequence length 411
Comment pep:novel supercontig:Nleu1.0:GL397430.1:1037743:1051072:-1 gene:ENSNLEG00000000789 transcript:ENSNLET00000000982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEMSEKENEPDDAATQSPPGTVSALQETKVTWGARGLSPPRAPRARAPSSRREGLGAER
QGPSNVVTSGPAPKPPSNPPSEASDRGLPTPSPSPCPIPRPLAALKPVRLHSFQEHVFKR
ASPCELCHQLIVGNSKQGLRCKTCKVSVHLWCYEEISHQQCPGKTSTSFRRNFSSPLLVH
EPPPACATSKESPPTGDSGKVDPVYETLRYGTSLALMNRSSFSSTSESPTRSLSERDELT
EDGEGSIRSSEEGPGDSASPVFTAPAEGEGPGPEEKSPGQQVSLSGVRDQPGQHSETPSV
LKIQKLAGHGGRCLPGDRIMLVDDSNEDWWKGKIGDRVGFFPANFVQRVRPGENVWRCCQ
PFSGNKEQGYMSLKENQICVGVGRSKDADGFIRVSSGKKRGLVPVDALTEI
Download sequence
Identical sequences ENSNLEP00000000924 ENSNLEP00000000924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]