SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000000927 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000000927
Domain Number 1 Region: 28-406
Classification Level Classification E-value
Superfamily RNI-like 6.02e-57
Family Cyclin A/CDK2-associated p19, Skp2 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000000927   Gene: ENSNLEG00000000798   Transcript: ENSNLET00000000985
Sequence length 434
Comment pep:novel supercontig:Nleu1.0:GL397430.1:1087790:1206556:-1 gene:ENSNLEG00000000798 transcript:ENSNLET00000000985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRDVNGVTKSRFEVAWGARAAIKFVFLSFLFRIFSFLDVVTLCRCAQVSRAWNVLALDG
SNWQRIDLFDFQRDIEGRVVENISKRCGGFLRKLSLRGCLGVGDNALRTFAQNCRNIEVL
NLNGCTKTTDATCTSLSKFCSKLRHLDLASCTSITNMSLKALSEGCPLLEQLNISWCDQV
TKDGIQALVRGCGGLKALFLKGCTQLEDEALKYIGAHCPELVTLNLQTCLQITDEGLITI
CRGCHKLQSLCASGCSNITDAILNALGQNCPRLRILEVARCSQLTDVGFTTLARNCHELE
KMDLEECVQITDSTLIQLSIHCPRLQVLSLSHCELITDDGIRHLGNGACAHDQLEVIELD
NCPLITDASLEHLKSCHSLERIELYDCQQITRAGIKRLRTHLPNIKVHAYFAPVTPPPSV
GGSRQRFCRCCIIL
Download sequence
Identical sequences ENSNLEP00000000927 ENSNLEP00000000927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]