SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001010 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001010
Domain Number 1 Region: 622-913
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.66e-100
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000862
Further Details:      
 
Domain Number 2 Region: 215-361
Classification Level Classification E-value
Superfamily PH domain-like 6.46e-40
Family Third domain of FERM 0.00011
Further Details:      
 
Domain Number 3 Region: 113-217
Classification Level Classification E-value
Superfamily Second domain of FERM 5.1e-37
Family Second domain of FERM 0.0000737
Further Details:      
 
Domain Number 4 Region: 27-111
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.96e-23
Family First domain of FERM 0.001
Further Details:      
 
Domain Number 5 Region: 510-604
Classification Level Classification E-value
Superfamily PDZ domain-like 1.46e-20
Family PDZ domain 0.0000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001010   Gene: ENSNLEG00000000805   Transcript: ENSNLET00000001071
Sequence length 926
Comment pep:novel supercontig:Nleu1.0:GL397409.1:68249:289050:1 gene:ENSNLEG00000000805 transcript:ENSNLET00000001071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSRFRLPAGRTYNVRASELARDRQHTEVVCNILLLDNTVQAFKVDKHDQGQVLLDIVFK
HLDLTEQDYFGLQLADDSTDNPRWLDPNKPIRKQLKRGSPYNLNFRVKFFVSDPNKLQEE
YTRYQYFLQIKQDILTGRLPCPSNTAALLASFAVQSELGDYDQSENLPGYLSDYSFIPNQ
PQDFEKEIAKLHQQHIGLSPAEAEFNYLNTARTLELYGVEFHYARDQSNNEIMIGVMSGG
ILIYKNRVRMNTFPWLKIVKISFKCKQFFIQLRKELHESRETLLGFNMVNYRACKNLWKA
CVEHHTFFRLDRPLPPQKNFFAHYFTLGSKFRYCGRTEVQSVQYGKEKANKDRVFARSPS
KPLARKLMDWEVVSRNSISDDRLETQSLPSRSPPGTPNHRNSTFTQEGTRLRPSSVGHLV
DHMVHTSPSEVFVNQRSPSSTQANSIVLESSPSQETPGDGKPPALPPKQSKKNSWNQIHY
SHSQQDLESHINETFDIPSSPEKPTPNGGIPHDNLVLIRMKPDENGRFGFNVKGGCDQKM
PVIVSRVAPGTPADLCVPRLNEGDQVVVINGRDITEHTHDQVVLFIKASCERHSGELMLL
VRPNAVYDVVEEKLENEPDFQYIPEKAPLDSVHQDDHSLRESMIQLAEGLITGTVLTQFD
QLYRKKPGMTMSCAKLPQNISKNRYRDISPYDATRVILKGNEDYINANYINMEIPSSSII
NQYIACQGPLPHTCTDFWQMTWEQGSSMVVMLTTQVERGRVKCHQYWPEPTGSSSYGCYQ
VTCHSEEGNTAYIFRKMTLFNQEKNESRPLTQIQYIAWPDHGVPDDSSDFLDFVCHVRNK
RAGKEEPVVVHCSAGIGRTGVLITMETAMCLIECNQPVYPLDIVRTMRDQRAMMIQTPSQ
YRFVCEAILKVYEEGFVKPLTTSSNK
Download sequence
Identical sequences G1QJB6
ENSNLEP00000001010 XP_003277221.1.23891 ENSNLEP00000001010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]