SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001073 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001073
Domain Number 1 Region: 761-1030
Classification Level Classification E-value
Superfamily RNI-like 3.14e-59
Family 28-residue LRR 0.0041
Further Details:      
 
Domain Number 2 Region: 34-111
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000000287
Family Caspase recruitment domain, CARD 0.0052
Further Details:      
 
Domain Number 3 Region: 132-214
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000000325
Family Caspase recruitment domain, CARD 0.0059
Further Details:      
 
Domain Number 4 Region: 294-473
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000164
Family G proteins 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001073   Gene: ENSNLEG00000000910   Transcript: ENSNLET00000001137
Sequence length 1040
Comment pep:novel supercontig:Nleu1.0:GL397289.1:3023432:3059617:1 gene:ENSNLEG00000000910 transcript:ENSNLET00000001137 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEEGGSVSHDEEERASVFLGHSPGCEMCSQEAFQAQRSQLVELLVSGSLEGFESVLDWL
LSWEVLSWEDYEGFHLLGQPLSHLARRLLDTVWNKGTWACQKLIAAAQEAQADSQSPKLH
GCWDPHSLHPARDLQSHRPAIVRRLHSHVEGVLDLAWERGFVSQYECDEIRLPIFTPSQR
ARRLLDLATVKANGLAAFLLQHVQELPVPLALPLEAATCKKYMAKLRTTVSAQSRFLSTY
DGAEMLCLEDIYTENVLEVWADVGMAGPPPKSPATLGLEELFSTPGHLNDDADTVLVVGE
AGSGKSTLLQRLHLLWAAGRDFQEFLFVFPFSCRQLQCMAKPLSVRTLLFEHCCWPDVGQ
EDIFQLLLDHPDRVLLTFDGFDEFKFRFTDRERHCSPTDPTSVQTLLFNLLQGNLLKNAR
KVVTSRPAAVSAFLRKYIRTEFNLKGFSEQGIELYLRKCHREPGVADRLIRLLQATSALH
GLCHLPVFSWMVSKCHQELLLQEGGSPKTTTDMYLLILQHFLLHAVPPDSASQGLGPSLL
RGRLPTLLHLGRLALWGLGMCCYVFSAQQLQAAQVSPDDISLGFLVRAKGVVPGSTAPLE
FLHITFQCFFAAFYLALSADVPPALLRHLFNCGRPGNSPMARLLPTLCIQGSEGKDSSAA
ALLQKAEPHNLQITAAFLAGLLSREHWGLLAECQTSEKALLRRQACARWCLARSLRKHFH
SIPPAAPGEAKSMHAMPGFIWLIRSLYEMQEERLARKAARGLNVGHLKLTFCSVGPAECA
ALAFVLQHLRRPVALQLDHNSVGDTGVEQLLPCLGVCKALYLRDNNISDRGICKLIECAL
HCEQLQKLALFNNKLTDGCAHSMAKLLACRQNFLALRLGNNHITAAGAQVLAEGLRGNTS
LQFLGFWGNRVGDEGAQALAEALGDHQSLRWLSLVGNNIGSVGAQALALMLAKNVMLEEL
CLEENHIQDEGVCSLAEGLKKNSSLKILKLSNNCITYLGAKALLQALERNDTILEVWLRG
NIFSLEEVDKLGCRDTRLLL
Download sequence
Identical sequences ENSNLEP00000001073 XP_012360135.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]