SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001082 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001082
Domain Number 1 Region: 479-576
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 2.09e-30
Family CUT domain 0.0000253
Further Details:      
 
Domain Number 2 Region: 366-450
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 3.68e-28
Family CUT domain 0.0000145
Further Details:      
 
Domain Number 3 Region: 671-735
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000727
Family Homeodomain 0.00015
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000001082
Domain Number - Region: 613-669
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00107
Family beta-sandwich domain of Sec23/24 0.012
Further Details:      
 
Domain Number - Region: 189-245
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00136
Family SinR domain-like 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001082   Gene: ENSNLEG00000000912   Transcript: ENSNLET00000001146
Sequence length 795
Comment pep:novel supercontig:Nleu1.0:GL397300.1:3066609:3158830:1 gene:ENSNLEG00000000912 transcript:ENSNLET00000001146 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHLNEATQGKEHSEMSNNVSDPKGPPAKIARLEQNGSPLGRGRLGSTGAKMQGVPLKHS
GHLMKTNLRKGTMLPVFCVVEHYENAIEYDCKEEHAEFVLVRKDMLFNQLIEMALLSLGY
SHSSAAQAKGLIQVGKWNPVPLSYVTDAPDATVADMLQDVYHVVTLKIQLHSCPKLEDLP
PEQWSHTTVRNALKDLLKDMNQSSLAKECPLSQSMISSIVNSTYYANVSAAKCQEFGRWY
KHFKKTKDMMVEMDSLSELSQQGANHVNFGQQPVPGNTAEQPPSPAQLSHGSQPSVRTPL
PNLHPGLVSTPISPQLVNQQLVMAQLLNQQYAVNRLLAQQSLNQQYLNHPPPVSRSMNKP
LEQQVSTNTEVSSEIYQWVRDELKRAGISQAVFARVAFNRTQGLLSEILRKEEDPKTASQ
SLLVNLRAMQNFLQLPEAERDRIYQDERERSLNAASAMGPAPLISTPPSRPPQVKTATIA
TERNGKPENNTMNINASIYDEIQQEMKRAKVSQALFAKVAATKSQGWLCELLRWKEDPSP
ENRTLWENLSMIRRFLSLPQPERDAIYEQESNAVHHHGDRPPHIIHVPAEQIQSPSPTTL
GKGESRGVFLPGLPTPAPWLGAAPQQQQQQQQQQQQQQQAPPPPQPQQQPQAGPRLPPRQ
PTVASPAESDEENRQKTRPRTKISVEALGILQSFIQDVGLYPDEEAIQTLSAQLDLPKYT
IIKFFQNQRYYLKHHGKLKDNSGLEVDVAEYKEEELLKDLEESVQDKNTNTLFSVKLEEE
LSVEGNTDINADLKD
Download sequence
Identical sequences G1QJI8
ENSNLEP00000001082 ENSNLEP00000001082 XP_003265342.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]