SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001217 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001217
Domain Number 1 Region: 183-306
Classification Level Classification E-value
Superfamily PH domain-like 2.18e-26
Family Third domain of FERM 0.0048
Further Details:      
 
Domain Number 2 Region: 84-180
Classification Level Classification E-value
Superfamily Second domain of FERM 1.03e-23
Family Second domain of FERM 0.001
Further Details:      
 
Domain Number 3 Region: 1-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.12e-20
Family First domain of FERM 0.0018
Further Details:      
 
Domain Number 4 Region: 381-430
Classification Level Classification E-value
Superfamily RING/U-box 0.0000971
Family RING finger domain, C3HC4 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001217   Gene: ENSNLEG00000001019   Transcript: ENSNLET00000001286
Sequence length 445
Comment pep:novel supercontig:Nleu1.0:GL397291.1:7004885:7023866:1 gene:ENSNLEG00000001019 transcript:ENSNLET00000001286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCYVTRPDAVLMEVEVEAKANGEDCLNQVCRRLGIIEVDYFGLQFTGSKGESLWLNLRN
RISQQMDGLAPYRLKLRVKFFVEPHLILQEQTRHIFFLHIKEALLAGHLLCSPEQAVELS
ALLAQTKFGDYNQNTAKYNYEELCAKELSSATLNSIVAKHKELEGTSQASAEYQVLQIVS
AMENYGIEWHSVRDSEGQKLLIGVGPEGISICKDDFSPINRIAYPVVQMATQSGKNVYLT
VTKESGNSIVLLFKMISTRAASGLYRAITETHAFYRCDTVTSAVMMQYSRDLKGHLASLF
LNENINLGKKYVFDIKRTSKEVYDHARRALYNAGVVDLVSRSNQSPSHSPLKSSESSMNC
SSCEGLSCQQTRALQEKLRKLKEAMLCMVCCEEEINSTFCPCGHTVCCESCAAQLQSCPV
CRSCVEHVQHVYLPTHTSLLNLTVI
Download sequence
Identical sequences G1QJX2
ENSNLEP00000001217 ENSNLEP00000001217 XP_003263586.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]