SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001318 from Nomascus leucogenys 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001318
Domain Number 1 Region: 233-306
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000012
Family Second domain of FERM 0.011
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000001318
Domain Number - Region: 9-115,193-230,267-298
Classification Level Classification E-value
Superfamily ARM repeat 0.000604
Family Regulatory subunit H of the V-type ATPase 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001318   Gene: ENSNLEG00000001125   Transcript: ENSNLET00000001396
Sequence length 331
Comment pep:novel supercontig:Nleu1.0:GL397452.1:771615:775765:1 gene:ENSNLEG00000001125 transcript:ENSNLET00000001396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WPQAPIQESLLSLSDDVSKLAVASFLALMRFMGDQSKPRGKDEMDLLYELLKLCQQEKLR
DEIYCQVIKQVTGHPRPEHCTRGWSFLSLLTGFFPPSTRLMPYLTKFLQDSGPSQELARS
SQEHLQRTVKYGGRRRMPPPGEMKAFLKGQAVRLLLIHLPGGVDYRTNIQTFTVAAEVQE
ELCREMGVTEPQEVQEFALFLIKEKGQLVRPLQPAEYLNSVVVNQDVSLHSRRLHWETPL
HFDNSTYISTHYSQVLWDYLQGKLPVSAKADVQLARLAALQHLSKANRNTPSEQDLLAYM
PKQLQRQVNTGLHQEPDGSELRRLEGHSPQE
Download sequence
Identical sequences ENSNLEP00000001318 ENSNLEP00000001318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]